Property Summary

NCBI Gene PubMed Count 3
Grant Count 3
R01 Count 3
Funding $277,115
PubMed Score 0.45
PubTator Score 0.92

Knowledge Summary

Patent

No data available

Gene RIF (2)

PMID Text
24706950 GAS2L1 and GAS2L2 are differentially involved in mediating the crosstalk between F-actin and microtubules.
12584248 The beta isoforms of hGAR17 and hGAR22 appear to be able to crosslink microtubules and microfilaments

AA Sequence

MSQPAGGRRKPRTLGPPVCSIRPFKSSEQYLEAMKEDLAEWLRDLYGLDIDAANFLQVLETGLVLCQHAN      1 - 70
VVTDAALAFLAEAPAQAQKIPMPRVGVSCNGAAQPGTFQARDNVSNFIQWCRKEMGIQEVLMFETEDLVL     71 - 140
RKNVKNVVLCLLELGRRAWRFGVAAPTLVQLEEEIEEEVRRELALPPPDPSPPAPPRRQPCHFRNLDQMV    141 - 210
QSLVSHCTCPVQFSMVKVSEGKYRVGDSNTLIFIRILRNHVMVRVGGGWDTLGHYLDKHDPCRCTSLSHK    211 - 280
PGSFLKPPAPPVQHEVRVQDGPSQTQPTMTISRSQSPPPPVDWKTYTSSDRRLRPPTPSSPRPRRERGAG    281 - 350
TGASREMAPFLRCQERSLIPSWRQPTAGDSPPSPQSSSTQKGRDPQCTSSGKREERYPPELPRGRIPTSW    351 - 420
VHEETDSWGTDAGNPTPQRLRAIEATTKGISARGPSPLPRSFGPAECLGLRLPLRDEAKGAFFQFREPES    421 - 490
VRSPTPVQGLTKIPIRLPPARPPTPGRSFPGATSGSPRTELGRDPIPLRAVTVDLAGSTHGDCSVEVRQE    491 - 560
DQQLDIQVMAEARESWDLGLQEQEGRYTPLPLGGNKEQAIYCSLEEEILGNMKLLEVRSACPQGTRSGVI    561 - 630
PRSGVYIPRLAGQWPEPGGPYDKAIQELAQGSPSLLKVDLEAWKAAPTGSPKPAVTPGPGSLKGKLGARQ    631 - 700
SGPRTKASLSAKGTHMRKVPPQGGQDCSASTVSASPEAPTPSPLDPNSDKAKACLSKGRRTLRKPKRVPS    701 - 770
IYKLKLRPRIRPRRDHRPEKQPSRIPRPLAYVFLGPARQPPKDRLLRAVLGSKGGEASRVDGASVGEEEE    771 - 840
EGKEEKEPAAPLESSPQPPEGLQPHWLNQAPLPPEEESWV                                  841 - 880
//

Text Mined References (3)

PMID Year Title
24706950 2014 GAS2-like proteins mediate communication between microtubules and actin through interactions with end-binding proteins.
12584248 2003 Protein products of human Gas2-related genes on chromosomes 17 and 22 (hGAR17 and hGAR22) associate with both microfilaments and microtubules.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.