Property Summary

NCBI Gene PubMed Count 39
PubMed Score 3.02
PubTator Score 71.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma 1.148 0.005
group 3 medulloblastoma 1.600 0.004
intraductal papillary-mucinous adenoma (... 1.100 0.001
intraductal papillary-mucinous neoplasm ... 1.300 0.002
diabetes mellitus -1.100 0.003
Breast cancer 2.100 0.044
ovarian cancer 1.400 0.004
pituitary cancer 1.100 0.000

Gene RIF (29)

PMID Text
26717976 the present study revealed that COP1 plays an important role in CLL cell proliferation and tumorigenicity, and may be a useful indicator of the chronic lymphocytic leukemia processes.
26254224 COP1 directly interacts with p27 through a VP motif on p27 and functions as an E3 ligase of p27 to accelerate the ubiquitin-mediated degradation of p27. COP1-p27 axis deregulation is involved in tumorigenesis.
25945542 COP1 overexpression leads to the cytoplasmic distribution of p27, thereby accelerating p27 degradation.
25884720 COP1 negatively regulates ETV1 in patients with triple-negative breast cancer.
25311538 TRIB2 associated-ubiquitin E3 ligases beta-transducin repeat-containing E3 ubiquitin protein ligase (beta-TrCP), COP1 and Smad ubiquitination regulatory factor 1 (Smurf1) reduced TCF4/beta-Catenin expression, and these effects could be enhanced by TRIB2.
25169772 changes in the expression of fast-responding early genes is modulated by huCOP1 in keratinocytes upon UVB irradiation
25117710 Phosphorylation of the ETS1 and ETS2 transcriptional oncoproteins at specific serine or threonine residues creates binding sites for the COP1 tumor suppressor protein.
24027432 co-expressing COP1 and active GSK3beta blocked in vitro cell growth/migration and in vivo metastasis of invasive breast cancer cells.
23933908 while the role of COP1 in malignancies is controversial, our current data support that COP1 acts as a tumor suppressor in gastric cancer.
23439647 COP1 physically interacted with PTP1B and suppressed PTP1B phosphatase activity as well as the association of PTP1B with IRbeta.
More...

AA Sequence

MSGSRQAGSGSAGTSPGSSAASSVTSASSSLSSSPSPPSVAVSAAALVSGGVAQAAGSGGLGGPVRPVLV      1 - 70
APAVSGSGGGAVSTGLSRHSCAARPSAGVGGSSSSLGSGSRKRPLLAPLCNGLINSYEDKSNDFVCPICF     71 - 140
DMIEEAYMTKCGHSFCYKCIHQSLEDNNRCPKCNYVVDNIDHLYPNFLVNELILKQKQRFEEKRFKLDHS    141 - 210
VSSTNGHRWQIFQDWLGTDQDNLDLANVNLMLELLVQKKKQLEAESHAAQLQILMEFLKVARRNKREQLE    211 - 280
QIQKELSVLEEDIKRVEEMSGLYSPVSEDSTVPQFEAPSPSHSSIIDSTEYSQPPGFSGSSQTKKQPWYN    281 - 350
STLASRRKRLTAHFEDLEQCYFSTRMSRISDDSRTASQLDEFQECLSKFTRYNSVRPLATLSYASDLYNG    351 - 420
SSIVSSIEFDRDCDYFAIAGVTKKIKVYEYDTVIQDAVDIHYPENEMTCNSKISCISWSSYHKNLLASSD    421 - 490
YEGTVILWDGFTGQRSKVYQEHEKRCWSVDFNLMDPKLLASGSDDAKVKLWSTNLDNSVASIEAKANVCC    491 - 560
VKFSPSSRYHLAFGCADHCVHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKP    561 - 630
YCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFV    631 - 700
SAVCWRALPDGESNVLIAANSQGTIKVLELV                                           701 - 731
//

Text Mined References (42)

PMID Year Title
26717976 2016 Expression and regulation of COP1 in chronic lymphocytic leukemia cells for promotion of cell proliferation and tumorigenicity.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26254224 2015 COP1 enhances ubiquitin-mediated degradation of p27Kip1 to promote cancer cell growth.
25945542 2015 Regulating the stability and localization of CDK inhibitor p27(Kip1) via CSN6-COP1 axis.
25884720 2015 COP1, the negative regulator of ETV1, influences prognosis in triple-negative breast cancer.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25311538 2014 TRIB2 inhibits Wnt/?-Catenin/TCF4 signaling through its associated ubiquitin E3 ligases, ?-TrCP, COP1 and Smurf1, in liver cancer cells.
25169772 2014 UVB-dependent changes in the expression of fast-responding early genes is modulated by huCOP1 in keratinocytes.
25117710 2014 Phosphorylation of ETS1 by Src family kinases prevents its recognition by the COP1 tumor suppressor.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
More...