Property Summary

NCBI Gene PubMed Count 45
PubMed Score 3.24
PubTator Score 71.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (8)

Disease log2 FC p
Breast cancer 2.100 4.4e-02
diabetes mellitus -1.100 3.4e-03
group 3 medulloblastoma 1.600 4.1e-03
intraductal papillary-mucinous adenoma (... 1.100 1.0e-03
intraductal papillary-mucinous neoplasm ... 1.300 1.6e-03
osteosarcoma 1.148 4.8e-03
ovarian cancer 1.400 4.3e-03
pituitary cancer 1.100 2.5e-05

Gene RIF (35)

AA Sequence

MSGSRQAGSGSAGTSPGSSAASSVTSASSSLSSSPSPPSVAVSAAALVSGGVAQAAGSGGLGGPVRPVLV      1 - 70
APAVSGSGGGAVSTGLSRHSCAARPSAGVGGSSSSLGSGSRKRPLLAPLCNGLINSYEDKSNDFVCPICF     71 - 140
DMIEEAYMTKCGHSFCYKCIHQSLEDNNRCPKCNYVVDNIDHLYPNFLVNELILKQKQRFEEKRFKLDHS    141 - 210
VSSTNGHRWQIFQDWLGTDQDNLDLANVNLMLELLVQKKKQLEAESHAAQLQILMEFLKVARRNKREQLE    211 - 280
QIQKELSVLEEDIKRVEEMSGLYSPVSEDSTVPQFEAPSPSHSSIIDSTEYSQPPGFSGSSQTKKQPWYN    281 - 350
STLASRRKRLTAHFEDLEQCYFSTRMSRISDDSRTASQLDEFQECLSKFTRYNSVRPLATLSYASDLYNG    351 - 420
SSIVSSIEFDRDCDYFAIAGVTKKIKVYEYDTVIQDAVDIHYPENEMTCNSKISCISWSSYHKNLLASSD    421 - 490
YEGTVILWDGFTGQRSKVYQEHEKRCWSVDFNLMDPKLLASGSDDAKVKLWSTNLDNSVASIEAKANVCC    491 - 560
VKFSPSSRYHLAFGCADHCVHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKP    561 - 630
YCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFV    631 - 700
SAVCWRALPDGESNVLIAANSQGTIKVLELV                                           701 - 731
//

Text Mined References (50)

PMID Year Title