Property Summary

NCBI Gene PubMed Count 29
Grant Count 12
R01 Count 10
Funding $823,714.22
PubMed Score 40.75
PubTator Score 33.50

Knowledge Summary

Patent (2,158)

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -2.324 0.000
medulloblastoma, large-cell 1.100 0.004
intraductal papillary-mucinous neoplasm ... 1.500 0.004
ovarian cancer 1.200 0.000

Gene RIF (16)

PMID Text
26918892 rs1551305 single nucleotide polymorphism is associated with type 2 diabetes risk.
26468524 Here, using live cell imaging, the authors obtained evidence that in contrast to the new model, ebolavirus enters cells through endolysosomes that contain both NPC1 and TPC2.
26202466 Results show that PDGs use previously unknown mechanisms of membrane dynamics and content exchange that are regulated by TPC2.
26152696 Studies suggest that both two-pore channels TPC1 and TPC2 as nicotinic acid adenine dinucleotide phosphate (NAADP) targets.
25722412 TPC1 and TPC2 proteins play a key role in Ebola virus infection and may be effective targets for antiviral therapy.
25451935 NAADP induced marked Ca(2+) transients in HEK293 cells that stably coexpressed hTPC2 with hTPC1 or cTPC3, but failed to evoke any such response in cells that coexpressed interacting hTPC2 and rTPC3 subunits
25416817 TPC2 is thus a potential drug target within a pathogenic LRRK2 cascade that disrupts Ca(2+)-dependent trafficking in Parkinson disease
25331892 These results demonstrate that a VEGFR2/NAADP/TPC2/Ca(2+) signaling pathway is critical for VEGF-induced angiogenesis
25236446 SNPs within Tpcn2 are associated with fasting insulin in humans.
25157141 TPC2, but not TPC1, caused a proliferation of endolysosomal structures, dysregulating intracellular trafficking, and cellular pigmentation.
More...

AA Sequence

MAEPQAESEPLLGGARGGGGDWPAGLTTYRSIQVGPGAAARWDLCIDQAVVFIEDAIQYRSINHRVDASS      1 - 70
MWLYRRYYSNVCQRTLSFTIFLILFLAFIETPSSLTSTADVRYRAAPWEPPCGLTESVEVLCLLVFAADL     71 - 140
SVKGYLFGWAHFQKNLWLLGYLVVLVVSLVDWTVSLSLVCHEPLRIRRLLRPFFLLQNSSMMKKTLKCIR    141 - 210
WSLPEMASVGLLLAIHLCLFTMFGMLLFAGGKQDDGQDRERLTYFQNLPESLTSLLVLLTTANNPDVMIP    211 - 280
AYSKNRAYAIFFIVFTVIGSLFLMNLLTAIIYSQFRGYLMKSLQTSLFRRRLGTRAAFEVLSSMVGEGGA    281 - 350
FPQAVGVKPQNLLQVLQKVQLDSSHKQAMMEKVRSYGSVLLSAEEFQKLFNELDRSVVKEHPPRPEYQSP    351 - 420
FLQSAQFLFGHYYFDYLGNLIALANLVSICVFLVLDADVLPAERDDFILGILNCVFIVYYLLEMLLKVFA    421 - 490
LGLRGYLSYPSNVFDGLLTVVLLVLEISTLAVYRLPHPGWRPEMVGLLSLWDMTRMLNMLIVFRFLRIIP    491 - 560
SMKLMAVVASTVLGLVQNMRAFGGILVVVYYVFAIIGINLFRGVIVALPGNSSLAPANGSAPCGSFEQLE    561 - 630
YWANNFDDFAAALVTLWNLMVVNNWQVFLDAYRRYSGPWSKIYFVLWWLVSSVIWVNLFLALILENFLHK    631 - 700
WDPRSHLQPLAGTPEATYQMTVELLFRDILEEPGEDELTERLSQHPHLWLCR                      701 - 752
//

Text Mined References (30)

PMID Year Title
26918892 2016 Genetic Variants of TPCN2 Associated with Type 2 Diabetes Risk in the Chinese Population.
26468524 2015 Ebolavirus Glycoprotein Directs Fusion through NPC1+ Endolysosomes.
26202466 2015 TPC2 mediates new mechanisms of platelet dense granule membrane dynamics through regulation of Ca2+ release.
26152696 2015 Function and dysfunction of two-pore channels.
25722412 2015 Ebola virus. Two-pore channels control Ebola virus host cell entry and are drug targets for disease treatment.
25451935 2015 Organelle-specific subunit interactions of the vertebrate two-pore channel family.
25416817 2015 Dysregulation of lysosomal morphology by pathogenic LRRK2 is corrected by TPC2 inhibition.
25331892 2014 VEGF-induced neoangiogenesis is mediated by NAADP and two-pore channel-2-dependent Ca2+ signaling.
25236446 2014 Identification of a novel gene for diabetic traits in rats, mice, and humans.
25157141 2014 The Two-pore channel (TPC) interactome unmasks isoform-specific roles for TPCs in endolysosomal morphology and cell pigmentation.
More...