Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.60
PubTator Score 1.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 1.7e-08
Disease Target Count Z-score Confidence
Malaria 160 0.0 2.0
Disease Target Count Z-score Confidence
Cryptorchidism 296 3.533 1.8
Azoospermia 110 3.241 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.100 1.7e-08

Gene RIF (1)

AA Sequence

MKKVKKKRSEARRHRDSTSQHASSNSTSQQPSPESTPQQPSPESTPQQPSPESTPQHSSLETTSRQPAFQ      1 - 70
ALPAPEIRRSSCCLLSPDANVKAAPQSRKAGPLIRAGPHSCSCATCPCSSACWRRLGLCHSRIFDVLLPR     71 - 140
DWQMAPGRGLPNLLTFYRKSSRKPSSHRNACPPSPRNCGCGSGGSRSCLLHH                      141 - 192
//

Text Mined References (7)

PMID Year Title