Property Summary

NCBI Gene PubMed Count 6
PubMed Score 28.99
PubTator Score 3.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
pituitary cancer 1972 1.5e-11
posterior fossa group B ependymoma 416 6.9e-04
oligodendroglioma 2850 4.3e-02
Disease Target Count Z-score Confidence
Ankyloglossia 17 4.57 2.3
Vestibular disease 1 3.25 1.6

Gene RIF (2)

AA Sequence

MQACMVPGLALCLLLGPLAGAKPVQEEGDPYAELPAMPYWPFSTSDFWNYVQHFQALGAYPQIEDMARTF      1 - 70
FAHFPLGSTLGFHVPYQED                                                        71 - 89
//

Text Mined References (6)

PMID Year Title