Property Summary

NCBI Gene PubMed Count 6
PubMed Score 28.31
PubTator Score 3.50

Knowledge Summary

Patent

No data available

Gene RIF (2)

PMID Text
25410892 study indicates a potentially protective role for the variant G alleles of SNPs rs77124181 and rs2291767 in Otos against the development of cisplatin-induced ototoxicity
12687421 OTOSP spans 1630 nucleotides, has 4 exons & encodes a 567-base cDNA. OTOSP is on chromosome 2 at position q37.3. Beside intronic polymorphisms, a rare variant (Pro7Leu) was found in deafness patients & controls, excluding it as a genetic deafness gene.

AA Sequence

MQACMVPGLALCLLLGPLAGAKPVQEEGDPYAELPAMPYWPFSTSDFWNYVQHFQALGAYPQIEDMARTF      1 - 70
FAHFPLGSTLGFHVPYQED                                                        71 - 89
//

Text Mined References (6)

PMID Year Title
25410892 2014 Genetic variation in Otos is associated with cisplatin-induced ototoxicity.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12687421 2003 Gene structure, chromosomal localization, and mutation screening of the human gene for the inner ear protein otospiralin.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11880501 2002 Downregulation of otospiralin, a novel inner ear protein, causes hair cell degeneration and deafness.