Property Summary

NCBI Gene PubMed Count 2
PubMed Score 60.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

AA Sequence

MPREDRATWKSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGKVVVLMGKNTMMRKAIRGHLE      1 - 70
NNPALEKLLPHIWGNVGFVFTKEDLTEIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQA     71 - 140
LGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNMLNISPFSFGLVIQQVFDNGSIYNPEVLDKTEET    141 - 210
LHSRFLEGVRNVASVCLQTGYPTVASVPHSIINGYKRVLALSVETDYTFPLAENVKAFLADPSAFVAAAP    211 - 280
VAADTTAAPAAAAAPAKVEAKEESEESDEDMGFGLFD                                     281 - 317
//

Text Mined References (2)

PMID Year Title