Property Summary

NCBI Gene PubMed Count 2
PubMed Score 58.48

Knowledge Summary


No data available


Accession Q8NHW5
Symbols RPLP0_2_209


AA Sequence

VAADTTAAPAAAAAPAKVEAKEESEESDEDMGFGLFD                                     281 - 317

Text Mined References (2)

PMID Year Title
19123937 2009 Comparative analysis of processed ribosomal protein pseudogenes in four mammalian genomes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.