Property Summary

NCBI Gene PubMed Count 2
Grant Count 4
Funding $148,695.14
PubMed Score 58.48

Knowledge Summary

Patent

No data available

Synonym

Accession Q8NHW5
Symbols RPLP0_2_209

Gene

AA Sequence

MPREDRATWKSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGKVVVLMGKNTMMRKAIRGHLE      1 - 70
NNPALEKLLPHIWGNVGFVFTKEDLTEIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQA     71 - 140
LGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNMLNISPFSFGLVIQQVFDNGSIYNPEVLDKTEET    141 - 210
LHSRFLEGVRNVASVCLQTGYPTVASVPHSIINGYKRVLALSVETDYTFPLAENVKAFLADPSAFVAAAP    211 - 280
VAADTTAAPAAAAAPAKVEAKEESEESDEDMGFGLFD                                     281 - 317
//

Text Mined References (2)

PMID Year Title
19123937 2009 Comparative analysis of processed ribosomal protein pseudogenes in four mammalian genomes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.