Property Summary

NCBI Gene PubMed Count 32
PubMed Score 374.99
PubTator Score 41.27

Knowledge Summary

Patent

No data available

Gene RIF (12)

AA Sequence

MKLCVTVLSLLVLVAAFCSLALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRG      1 - 70
KQVCADPSESWVQEYVYDLELN                                                     71 - 92
//

Text Mined References (33)

PMID Year Title