Property Summary

NCBI Gene PubMed Count 32
Grant Count 119
R01 Count 71
Funding $6,479,233.14
PubMed Score 361.74
PubTator Score 41.27

Knowledge Summary

Patent

No data available

Synonym

Accession Q8NHW4 B2RUZ3 B7ZMA8 Q50EM1 Q50EM2 Q50EM3 Q50EM4 Q50EM5 Q50EM6 Q50EM7 Q50EM8 Q569J2 Q6NSB0
Symbols CCL4L
SCYA4L
AT744.2
SCYQ4L2

Gene

Gene RIF (12)

PMID Text
25449536 identified 13 ADCC-activated genes. Six gene expression assays including 8 of the 13 genes (CCL3, CCL4/CCL4L1/CCL4L2, CD160, IFNG, NR4A3 and XCL1/XCL2) were analyzed in 127 kidney biopsies
24727646 PCR results show that lower copy numbers of CCL4L2 are observed in the Caucasian population nd higher copy numbers are observed in the Black population of South Africa.
21614014 CCL4L1 allele frequency is higher in severe psoriasis, whereas CCL4L2 is more frequent in patients with a milder disease.
20659124 Studies indicate that complete phenotypic impact requires dissecting the combinatorial genomic complexity posed by various proportions of distinct CCL3L and CCL4L genes among individuals.
19898927 higher level of expression at systemic level is associated with protection from HIV-1 infection in women from Benin
19279442 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19148142 A combined analysis of CCL4L copy number variation and the rs4796195 CCL4L single nucleotide polymorphism demonstrated that the effect of CCL4L copy number in acute rejection is mainly because of the number of copies of the CCL4L1 allelic variant.
19148142 Observational study of gene-disease association. (HuGE Navigator)
18464913 Observational study of gene-disease association. (HuGE Navigator)
18368065 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MKLCVTVLSLLVLVAAFCSLALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRG      1 - 70
KQVCADPSESWVQEYVYDLELN                                                     71 - 92
//

Text Mined References (33)

PMID Year Title
25449536 2015 Genes associated with antibody-dependent cell activation are overexpressed in renal biopsies from patients with antibody-mediated rejection.
24727646 2014 Comparison of a quantitative Real-Time PCR assay and droplet digital PCR for copy number analysis of the CCL4L genes.
21614014 2011 CCL4L polymorphisms and CCL4/CCL4L serum levels are associated with psoriasis severity.
20659124 2010 Copy number variation in chemokine superfamily: the complex scene of CCL3L-CCL4L genes in health and disease.
19898927 2010 Chemokine expression patterns in the systemic and genital tract compartments are associated with HIV-1 infection in women from Benin.
19279442 2009 Combinatorial content of CCL3L and CCL4L gene copy numbers influence HIV-AIDS susceptibility in Ukrainian children.
19148142 2009 Copy number variation in the CCL4L gene is associated with susceptibility to acute rejection in lung transplantation.
18464913 2008 A genome-wide association study identifies protein quantitative trait loci (pQTLs).
18368065 2008 Population structure in copy number variation and SNPs in the CCL4L chemokine gene.
17330138 2007 CCL3L1 and CCL4L1: variable gene copy number in adolescents with and without human immunodeficiency virus type 1 (HIV-1) infection.
More...