Property Summary

NCBI Gene PubMed Count 32
PubMed Score 23.00
PubTator Score 78.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Cancer 2499 0.0 4.0
Disease Target Count Z-score Confidence
diabetes mellitus 1728 3.549 1.8

Expression

Gene RIF (28)

AA Sequence

MAAELAMGAELPSSPLAIEYVNDFDLMKFEVKKEPPEAERFCHRLPPGSLSSTPLSTPCSSVPSSPSFCA      1 - 70
PSPGTGGGGGAGGGGGSSQAGGAPGPPSGGPGAVGGTSGKPALEDLYWMSGYQHHLNPEALNLTPEDAVE     71 - 140
ALIGSGHHGAHHGAHHPAAAAAYEAFRGPGFAGGGGADDMGAGHHHGAHHAAHHHHAAHHHHHHHHHHGG    141 - 210
AGHGGGAGHHVRLEERFSDDQLVSMSVRELNRQLRGFSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRH    211 - 280
ILESEKCQLQSQVEQLKLEVGRLAKERDLYKEKYEKLAGRGGPGSAGGAGFPREPSPPQAGPGGAKGTAD    281 - 350
FFL                                                                       351 - 353
//

Text Mined References (37)

PMID Year Title