Property Summary

NCBI Gene PubMed Count 30
Grant Count 123
R01 Count 77
Funding $13,907,745.28
PubMed Score 22.51
PubTator Score 78.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

Synonym

Accession Q8NHW3
Symbols hMafA
RIPE3b1

Gene

PANTHER Protein Class (1)

PDB

4EOT  

Gene RIF (26)

PMID Text
26546820 These findings demonstrate that regulation of monoamine levels by Mao activity in beta cells is pivotal for physiological insulin secretion and that loss of MaoB expression may contribute to the beta cell dysfunction in type 2 diabetes.
24157940 Loss of MAFA expression is associated with insulinoma.
24013263 MAFA nuclear expression in pancreatic alpha and beta cells, and the percentage of alpha cells expressing PAX4 are altered in patients with type 2 diabetes.
23863625 MAFA, MAFB, NKX6.1, and PDX1 activity provides a gauge of islet beta cell function, with loss of MAFA (and/or MAFB) representing an early indicator of beta cell inactivity
23660596 under oxidative and nonoxidative conditions p38 MAPK directly binds to MafA and triggers MafA degradation via ubiquitin proteasomal pathway.
22847061 Beta cell nuclear MafA is markedly decreased in humans with type 2 diabetes, which may contribute to impaired beta cell dysfunction.
22761608 Combined transfection of the three transcriptional factors, PDX-1, NeuroD1, and MafA, causes differentiation of bone marrow mesenchymal stem cells into insulin-producing cells
21278484 MafA transcription is upregulated in beta-cells acutely cultured in high glucose similar to what may occur in vivo under normoglycemic conditions.
21278380 ATF2 interacts with beta-cell-enriched transcription factors, MafA, Pdx1, and beta2, and activates insulin gene transcription.
20213756 In addition to its expression in pancreatic beta cells, MafA also identifies the early ret-expressing sensory neurons in the dorsal root ganglia.
More...

AA Sequence

MAAELAMGAELPSSPLAIEYVNDFDLMKFEVKKEPPEAERFCHRLPPGSLSSTPLSTPCSSVPSSPSFCA      1 - 70
PSPGTGGGGGAGGGGGSSQAGGAPGPPSGGPGAVGGTSGKPALEDLYWMSGYQHHLNPEALNLTPEDAVE     71 - 140
ALIGSGHHGAHHGAHHPAAAAAYEAFRGPGFAGGGGADDMGAGHHHGAHHAAHHHHAAHHHHHHHHHHGG    141 - 210
AGHGGGAGHHVRLEERFSDDQLVSMSVRELNRQLRGFSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRH    211 - 280
ILESEKCQLQSQVEQLKLEVGRLAKERDLYKEKYEKLAGRGGPGSAGGAGFPREPSPPQAGPGGAKGTAD    281 - 350
FFL                                                                       351 - 353
//

Text Mined References (34)

PMID Year Title
26546820 2015 Islet-specific monoamine oxidase A and B expression depends on MafA transcriptional activity and is compromised in type 2 diabetes.
24157940 2013 Altered MENIN expression disrupts the MAFA differentiation pathway in insulinoma.
24013263 2013 Both PAX4 and MAFA are expressed in a substantial proportion of normal human pancreatic alpha cells and deregulated in patients with type 2 diabetes.
23863625 2013 Inactivation of specific ? cell transcription factors in type 2 diabetes.
23660596 2013 Preventing p38 MAPK-mediated MafA degradation ameliorates ?-cell dysfunction under oxidative stress.
23148532 2012 A novel DNA binding mechanism for maf basic region-leucine zipper factors inferred from a MafA-DNA complex structure and binding specificities.
22847061 2012 Beta cell nuclear musculoaponeurotic fibrosarcoma oncogene family A (MafA) is deficient in type 2 diabetes.
22761608 2012 Combined transfection of the three transcriptional factors, PDX-1, NeuroD1, and MafA, causes differentiation of bone marrow mesenchymal stem cells into insulin-producing cells.
21278484 Regulation of ?-cell-specific and glucose-dependent MafA expression.
21278380 2011 ATF2 interacts with beta-cell-enriched transcription factors, MafA, Pdx1, and beta2, and activates insulin gene transcription.
More...