Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.38
PubTator Score 8.02

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MARSLVHDTVFYCLSVYQVKISPTPQLGAASSAEGHVGQGAPGLMGNMNPEGGVNHENGMNRDGGMIPEG      1 - 70
GGGNQEPRQQPQPPPEEPAQAAMEGPQPENMQPRTRRTKFTLLQVEELESVFRHTQYPDVPTRRELAENL     71 - 140
GVTEDKVRVWFKNKRARCRRHQRELMLANELRADPDDCVYIVVD                              141 - 184
//

Text Mined References (13)

PMID Year Title