Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.38
PubTator Score 8.02

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
11980563 cloning and characterization of human OTEX

AA Sequence

MARSLVHDTVFYCLSVYQVKISPTPQLGAASSAEGHVGQGAPGLMGNMNPEGGVNHENGMNRDGGMIPEG      1 - 70
GGGNQEPRQQPQPPPEEPAQAAMEGPQPENMQPRTRRTKFTLLQVEELESVFRHTQYPDVPTRRELAENL     71 - 140
GVTEDKVRVWFKNKRARCRRHQRELMLANELRADPDDCVYIVVD                              141 - 184
//

Text Mined References (11)

PMID Year Title
21609483 2011 Homeobox gene Rhox5 is regulated by epigenetic mechanisms in cancer and stem cells and promotes cancer growth.
19679824 2009 Three epigenetic drugs up-regulate homeobox gene Rhox5 in cancer cells through overlapping and distinct molecular mechanisms.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16244364 2005 Conservation and variation of gene regulation in embryonic stem cells assessed by comparative genomics.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
12490318 2002 Two novel human X-linked homeobox genes, hPEPP1 and hPEPP2, selectively expressed in the testis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...