Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -2.000 1.9e-04
Astrocytoma, Pilocytic -1.100 1.4e-03
atypical teratoid / rhabdoid tumor -2.100 3.4e-08
ependymoma -1.400 1.6e-07
gastric cancer 1.100 1.1e-03
glioblastoma -1.200 4.2e-04
group 3 medulloblastoma -1.200 1.0e-03
hepatocellular carcinoma 1.200 7.3e-07
medulloblastoma, large-cell -2.700 1.7e-05
ovarian cancer -1.200 2.1e-04
primitive neuroectodermal tumor -1.100 2.7e-03
subependymal giant cell astrocytoma -1.933 1.9e-02
tuberculosis and treatment for 6 months -1.300 6.9e-04

AA Sequence

MDKLTIISGCLFLAADIFAIASIANPDWINTGESAGALTVGLVRQCQTIHGRDRTCIPPRLPPEWVTTLF      1 - 70
FIIMGIISLTVTCGLLVASHWRREATKYARWIAFTGMILFCMAALIFPIGFYINEVGGQPYKLPNNTVVG     71 - 140
SSYVLFVLSIFFTIVGLLFAGKVCLPG                                               141 - 167
//

Text Mined References (5)

PMID Year Title