Property Summary

NCBI Gene PubMed Count 26
PubMed Score 27.41
PubTator Score 19.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
astrocytoma 1493 4.36733102821682E-25
ependymoma 2514 2.12881019605626E-14
oligodendroglioma 2849 5.57591774367693E-14
atypical teratoid / rhabdoid tumor 4369 2.27520413414759E-9
primitive neuroectodermal tumor 3031 5.26005316507104E-7
pediatric high grade glioma 2712 6.10036776999837E-7
medulloblastoma 1524 7.68794833663678E-7
pilocytic astrocytoma 3086 2.28608404739981E-6
glioblastoma 5572 4.26040923580292E-5
medulloblastoma, large-cell 6234 4.81831675669175E-5
tuberculosis and treatment for 6 months 686 1.70751006197445E-4
nasopharyngeal carcinoma 1056 0.00284358620141795
osteosarcoma 7933 0.00393459748456342
Breast cancer 3099 0.0215258560780546
Disease Target Count Z-score Confidence
Schizophrenia 503 0.0 1.0

Expression

  Differential Expression (14)

Disease log2 FC p
ependymoma 2.300 0.000
astrocytoma 1.300 0.000
glioblastoma 2.500 0.000
oligodendroglioma 1.100 0.000
osteosarcoma 1.542 0.004
medulloblastoma 2.000 0.000
atypical teratoid / rhabdoid tumor 2.700 0.000
medulloblastoma, large-cell 2.200 0.000
primitive neuroectodermal tumor 2.100 0.000
tuberculosis and treatment for 6 months 1.200 0.000
Breast cancer 4.800 0.022
pediatric high grade glioma 2.300 0.000
pilocytic astrocytoma 1.400 0.000
nasopharyngeal carcinoma 1.700 0.003

Synonym

Accession Q8NHV4 B0AZN0 B4E145 G3V3F1 Q8NA30
Symbols GCP-WD
TUBGCP7

Gene

  Ortholog (10)

Gene RIF (10)

PMID Text
23273898 One important function of Aurora A in mitotic cells is to promote microtubule nucleation around the chromatin by phosphorylating NEDD1, and thereby to promote functional spindle assembly.
23106787 The mice treated with small interfering (si) RNA targeting NEDD1 by the atelocollagen-mediated delivery system showed a significantly prolonged survival in a xenograft model of human gastric cancer.
22818914 Nek9 phosphorylates NEDD1 on Ser377 driving its recruitment and thereby that of gamma-tubulin to the centrosome in mitotic cells.
22595525 Data suggest that the NEDD1/gamma-tubulin interaction is finely tuned by multiple phosphorylation events in the S557-S574 region and is critical for spindle assembly.
20224777 a direct interaction with NEDD1 regulates gamma-tubulin recruitment to the centrosome
19509060 Data suggest that sequential phosphorylation of Nedd1 by Cdk1 and Plk1 plays a role in targeting gamma tubulin ring complex to the centrosome by promoting the interaction of Nedd1 with the gammaTuRC component gamma-tubulin, during mitosis.
19243593 Data propose NEDD1 may be a promising target for controlling cell proliferation, in particular if targeted in combination with Plk1 inhibitors.
19029337 FAM29A promotes microtubule amplification via recruitment of the NEDD1-gamma-tubulin complex to the mitotic spindle.
16461362 The NEED1 protein was characterized and its function in centriole duplication and spindle assembly determined.
16378099 GCP-WD (NEDD1) broadly mediates targeting of the gamma-tubulin ring complex to sites of microtubule nucleation and to the mitotic spindle, which is essential for spindle formation.

AA Sequence

MQENLRFASSGDDIKIWDASSMTLVDKFNPHTSPHGISSICWSSNNNFLVTASSSGDKIVVSSCKCKPVP      1 - 70
LLELAEGQKQTCVNLNSTSMYLVSGGLNNTVNIWDLKSKRVHRSLKDHKDQVTCVTYNWNDCYIASGSLS     71 - 140
GEIILHSVTTNLSSTPFGHGSNQSVRHLKYSLFKKSLLGSVSDNGIVTLWDVNSQSPYHNFDSVHKAPAS    141 - 210
GICFSPVNELLFVTIGLDKRIILYDTSSKKLVKTLVADTPLTAVDFMPDGATLAIGSSRGKIYQYDLRML    211 - 280
KSPVKTISAHKTSVQCIAFQYSTVLTKSSLNKGCSNKPTTVNKRSVNVNAASGGVQNSGIVREAPATSIA    281 - 350
TVLPQPMTSAMGKGTVAVQEKAGLPRSINTDTLSKETDSGKNQDFSSFDDTGKSSLGDMFSPIRDDAVVN    351 - 420
KGSDESIGKGDGFDFLPQLNSVFPPRKNPVTSSTSVLHSSPLNVFMGSPGKEENENRDLTAESKKIYMGK    421 - 490
QESKDSFKQLAKLVTSGAESGNLNTSPSSNQTRNSEKFEKPENEIEAQLICEPPINGSSTPNPKIASSVT    491 - 560
AGVASSLSEKIADSIGNNRQNAPLTSIQIRFIQNMIQETLDDFREACHRDIVNLQVEMIKQFHMQLNEMH    561 - 630
SLLERYSVNEGLVAEIERLREENKRLRAHF                                            631 - 660
//

Text Mined References (33)

PMID Year Title
24189344 2014 Common genetic variants on 1p13.2 associate with risk of autism.
23273898 2013 The role of NEDD1 phosphorylation by Aurora A in chromosomal microtubule nucleation and spindle function.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23106787 2013 Intraperitoneal delivery of a small interfering RNA targeting NEDD1 prolongs the survival of scirrhous gastric cancer model mice.
22818914 2012 Nek9 phosphorylation of NEDD1/GCP-WD contributes to Plk1 control of ?-tubulin recruitment to the mitotic centrosome.
22747683 2012 Genetic variants associated with breast size also influence breast cancer risk.
22595525 2012 Novel NEDD1 phosphorylation sites regulate ?-tubulin binding and mitotic spindle assembly.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
20224777 2010 A direct interaction with NEDD1 regulates gamma-tubulin recruitment to the centrosome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...