Property Summary

NCBI Gene PubMed Count 28
PubMed Score 25.91
PubTator Score 19.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma 1.400 1.8e-04
astrocytoma 1.300 4.4e-25
Astrocytoma, Pilocytic 1.400 3.0e-06
atypical teratoid / rhabdoid tumor 2.700 2.3e-09
Breast cancer 4.800 2.2e-02
ependymoma 1.800 4.4e-02
glioblastoma 1.900 8.4e-08
group 3 medulloblastoma 1.300 8.6e-04
medulloblastoma, large-cell 2.200 4.8e-05
nasopharyngeal carcinoma 1.700 2.8e-03
oligodendroglioma 1.100 5.6e-14
osteosarcoma 1.542 3.9e-03
primitive neuroectodermal tumor 2.100 5.3e-07
tuberculosis and treatment for 6 months 1.200 1.7e-04

Gene RIF (10)

AA Sequence

MQENLRFASSGDDIKIWDASSMTLVDKFNPHTSPHGISSICWSSNNNFLVTASSSGDKIVVSSCKCKPVP      1 - 70
LLELAEGQKQTCVNLNSTSMYLVSGGLNNTVNIWDLKSKRVHRSLKDHKDQVTCVTYNWNDCYIASGSLS     71 - 140
GEIILHSVTTNLSSTPFGHGSNQSVRHLKYSLFKKSLLGSVSDNGIVTLWDVNSQSPYHNFDSVHKAPAS    141 - 210
GICFSPVNELLFVTIGLDKRIILYDTSSKKLVKTLVADTPLTAVDFMPDGATLAIGSSRGKIYQYDLRML    211 - 280
KSPVKTISAHKTSVQCIAFQYSTVLTKSSLNKGCSNKPTTVNKRSVNVNAASGGVQNSGIVREAPATSIA    281 - 350
TVLPQPMTSAMGKGTVAVQEKAGLPRSINTDTLSKETDSGKNQDFSSFDDTGKSSLGDMFSPIRDDAVVN    351 - 420
KGSDESIGKGDGFDFLPQLNSVFPPRKNPVTSSTSVLHSSPLNVFMGSPGKEENENRDLTAESKKIYMGK    421 - 490
QESKDSFKQLAKLVTSGAESGNLNTSPSSNQTRNSEKFEKPENEIEAQLICEPPINGSSTPNPKIASSVT    491 - 560
AGVASSLSEKIADSIGNNRQNAPLTSIQIRFIQNMIQETLDDFREACHRDIVNLQVEMIKQFHMQLNEMH    561 - 630
SLLERYSVNEGLVAEIERLREENKRLRAHF                                            631 - 660
//

Text Mined References (35)

PMID Year Title