Property Summary

NCBI Gene PubMed Count 14
PubMed Score 13.80
PubTator Score 7.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 7.9e-04
cutaneous lupus erythematosus 1.200 2.2e-03
dermatomyositis 1.400 1.2e-02
group 4 medulloblastoma -1.200 1.4e-03
intraductal papillary-mucinous neoplasm ... 1.400 1.5e-02
juvenile dermatomyositis 1.818 5.9e-12
lung cancer -1.800 1.5e-02
medulloblastoma, large-cell -2.200 4.0e-04
Multiple Sclerosis 1.300 6.8e-03
osteosarcoma -1.746 1.8e-04
ovarian cancer -1.300 8.3e-07

Gene RIF (3)

AA Sequence

MLEGDLVSKMLRAVLQSHKNGVALPRLQGEYRSLTGDWIPFKQLGFPTLEAYLRSVPAVVRIETSRSGEI      1 - 70
TCYAMACTETARIAQLVARQRSSKRKTGRQVNCQMRVKKTMPFFLEGKPKATLRQPGFASNFSVGKKPNP     71 - 140
APLRDKGNSVGVKPDAEMSPYMLHTTLGNEAFKDIPVQRHVTMSTNNRFSPKASLQPPLQMHLSRTSTKE    141 - 210
MSDNLNQTVEKPNVKPPASYTYKMDEVQNRIKEILNKHNNGIWISKLPHFYKELYKEDLNQGILQQFEHW    211 - 280
PHICTVEKPCSGGQDLLLYPAKRKQLLRSELDTEKVPLSPLPGPKQTPPLKGCPTVMAGDFKEKVADLLV    281 - 350
KYTSGLWASALPKAFEEMYKVKFPEDALKNLASLSDVCSIDYISGNPQKAILYAKLPLPTDKIQKDAGQA    351 - 420
HGDNDIKAMVEQEYLQVEESIAESANTFMEDITVPPLMIPTEASPSVLVVELSNTNEVVIRYVGKDYSAA    421 - 490
QELMEDEMKEYYSKNPKITPVQAVNVGQLLAVNAEEDAWLRAQVISTEENKIKVCYVDYGFSENVEKSKA    491 - 560
YKLNPKFCSLSFQATKCKLAGLEVLSDDPDLVKVVESLTCGKIFAVEILDKADIPLVVLYDTSGEDDINI    561 - 630
NATCLKAICDKSLEVHLQVDAMYTNVKVTNICSDGTLYCQVPCKGLNKLSDLLRKIEDYFHCKHMTSECF    631 - 700
VSLPFCGKICLFHCKGKWLRVEITNVHSSRALDVQFLDSGTVTSVKVSELREIPPRFLQEMIAIPPQAIK    701 - 770
CCLADLPQSIGMWTPDAVLWLRDSVLNCSDCSIKVTKVDETRGIAHVYLFTPKNFPDPHRSINRQITNAD    771 - 840
LWKHQKDVFLSAISSGADSPNSKNGNMPMSGNTGENFRKNLTDVIKKSMVDHTSAFSTEELPPPVHLSKP    841 - 910
GEHMDVYVPVACHPGYFVIQPWQEIHKLEVLMEEMILYYSVSEERHIAVEKDQVYAAKVENKWHRVLLKG    911 - 980
ILTNGLVSVYELDYGKHELVNIRKVQPLVDMFRKLPFQAVTAQLAGVKCNQWSEEASMVFRNHVEKKPLV    981 - 1050
ALVQTVIENANPWDRKVVVYLVDTSLPDTDTWIHDFMSEYLIELSKVN                         1051 - 1098
//

Text Mined References (23)

PMID Year Title