Property Summary

NCBI Gene PubMed Count 14
Grant Count 8
R01 Count 8
Funding $1,118,317.23
PubMed Score 13.43
PubTator Score 7.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Gene RIF (3)

PMID Text
25120344 Human cataracts and the TDRD7 gene loss-of-function mutations are strongly causally related, as the expression level of plasma TDRD7 mRNA in patients with cataracts was statistically significantly lower than in the normal control group.
24435515 present study suggests that the rs10981985 G --> A variant within the TDRD7 gene may protect against cortical age-related cataract in a Han Chinese population
21436445 study describes 2 cases of pediatric cataract with loss-of-function mutations in TDRD7; TDRD7 coimmunoprecipitates with specific lens mRNAs; required for posttranscriptional control of mRNAs critical to normal lens development and RNA granule function

AA Sequence

MLEGDLVSKMLRAVLQSHKNGVALPRLQGEYRSLTGDWIPFKQLGFPTLEAYLRSVPAVVRIETSRSGEI      1 - 70
TCYAMACTETARIAQLVARQRSSKRKTGRQVNCQMRVKKTMPFFLEGKPKATLRQPGFASNFSVGKKPNP     71 - 140
APLRDKGNSVGVKPDAEMSPYMLHTTLGNEAFKDIPVQRHVTMSTNNRFSPKASLQPPLQMHLSRTSTKE    141 - 210
MSDNLNQTVEKPNVKPPASYTYKMDEVQNRIKEILNKHNNGIWISKLPHFYKELYKEDLNQGILQQFEHW    211 - 280
PHICTVEKPCSGGQDLLLYPAKRKQLLRSELDTEKVPLSPLPGPKQTPPLKGCPTVMAGDFKEKVADLLV    281 - 350
KYTSGLWASALPKAFEEMYKVKFPEDALKNLASLSDVCSIDYISGNPQKAILYAKLPLPTDKIQKDAGQA    351 - 420
HGDNDIKAMVEQEYLQVEESIAESANTFMEDITVPPLMIPTEASPSVLVVELSNTNEVVIRYVGKDYSAA    421 - 490
QELMEDEMKEYYSKNPKITPVQAVNVGQLLAVNAEEDAWLRAQVISTEENKIKVCYVDYGFSENVEKSKA    491 - 560
YKLNPKFCSLSFQATKCKLAGLEVLSDDPDLVKVVESLTCGKIFAVEILDKADIPLVVLYDTSGEDDINI    561 - 630
NATCLKAICDKSLEVHLQVDAMYTNVKVTNICSDGTLYCQVPCKGLNKLSDLLRKIEDYFHCKHMTSECF    631 - 700
VSLPFCGKICLFHCKGKWLRVEITNVHSSRALDVQFLDSGTVTSVKVSELREIPPRFLQEMIAIPPQAIK    701 - 770
CCLADLPQSIGMWTPDAVLWLRDSVLNCSDCSIKVTKVDETRGIAHVYLFTPKNFPDPHRSINRQITNAD    771 - 840
LWKHQKDVFLSAISSGADSPNSKNGNMPMSGNTGENFRKNLTDVIKKSMVDHTSAFSTEELPPPVHLSKP    841 - 910
GEHMDVYVPVACHPGYFVIQPWQEIHKLEVLMEEMILYYSVSEERHIAVEKDQVYAAKVENKWHRVLLKG    911 - 980
ILTNGLVSVYELDYGKHELVNIRKVQPLVDMFRKLPFQAVTAQLAGVKCNQWSEEASMVFRNHVEKKPLV    981 - 1050
ALVQTVIENANPWDRKVVVYLVDTSLPDTDTWIHDFMSEYLIELSKVN                         1051 - 1098
//

Text Mined References (23)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25120344 2014 Comparative quantification of plasma TDRD7 mRNA in cataract patients by real-time polymerase chain reaction.
24435515 2014 RNA granule component TDRD7 gene polymorphisms in a Han Chinese population with age-related cataract.
23847690 2011 RNA Granules and Cataract.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21436445 2011 Mutations in the RNA granule component TDRD7 cause cataract and glaucoma.
20305267 2010 LOTUS, a new domain associated with small RNA pathways in the germline.
20302647 2010 OST-HTH: a novel predicted RNA-binding domain.
More...