Property Summary

NCBI Gene PubMed Count 22
PubMed Score 31.12
PubTator Score 39.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
active Crohn's disease 1.018 7.3e-03
active ulcerative colitis 1.355 2.6e-02
atypical teratoid / rhabdoid tumor 1.800 2.6e-02
Breast cancer -1.800 1.1e-06
ependymoma 1.600 9.4e-07
group 3 medulloblastoma -1.500 4.9e-03
hepatocellular carcinoma 1.100 6.8e-04
intraductal papillary-mucinous neoplasm ... 1.800 1.9e-02
lung adenocarcinoma -1.200 2.6e-09
lung carcinoma -2.200 9.7e-17
medulloblastoma, large-cell 1.200 2.1e-04
nasopharyngeal carcinoma -2.500 2.9e-05
non diabetic and post-ischemic heart fai... -1.200 3.2e-02
non-small cell lung cancer -2.145 6.3e-16
osteosarcoma 3.175 2.2e-03
ovarian cancer -2.500 2.3e-05
pituitary cancer -3.600 2.8e-08
Rheumatoid arthritis 1.500 4.8e-02
spina bifida -2.587 1.7e-02
tuberculosis -1.200 1.7e-03

Gene RIF (18)

AA Sequence

MDIIETAKLEEHLENQPSDPTNTYARPAEPVEEENKNGNGKPKSLSSGLRKGTKKYPDYIQIAMPTESRN      1 - 70
KFPLEWWKTGIAFIYAVFNLVLTTVMITVVHERVPPKELSPPLPDKFFDYIDRVKWAFSVSEINGIILVG     71 - 140
LWITQWLFLRYKSIVGRRFCFIIGTLYLYRCITMYVTTLPVPGMHFQCAPKLNGDSQAKVQRILRLISGG    141 - 210
GLSITGSHILCGDFLFSGHTVTLTLTYLFIKEYSPRHFWWYHLICWLLSAAGIICILVAHEHYTIDVIIA    211 - 280
YYITTRLFWWYHSMANEKNLKVSSQTNFLSRAWWFPIFYFFEKNVQGSIPCCFSWPLSWPPGCFKSSCKK    281 - 350
YSRVQKIGEDNEKST                                                           351 - 365
//

Text Mined References (25)

PMID Year Title