Property Summary

NCBI Gene PubMed Count 19
Grant Count 6
R01 Count 2
Funding $590,899.15
PubMed Score 24.77
PubTator Score 39.13

Knowledge Summary

Patent

No data available

Expression

Gene RIF (17)

PMID Text
25231990 F-actin polymerization in the region of HIV-1 membrane fusion was more prominent in Sms2-expressing cells than Sms-deficient cells.
25231990 SMS2 is involved in HIV-1 gp120-induced phosphorylation and activation of PYK2 and polymerization of F-actin
25231990 SMS2 is involved in HIV-1 gp120-induced phosphorylation and activation of PYK2 and polymerization of F-actin
25231990 SMS2 is involved in HIV-1 gp120-induced phosphorylation and activation of PYK2 and polymerization of F-actin
22106271 Data indicate that the increased sphingomyelin mass was due to a rapid and highly specific activation of sphingomyelin synthases SMS1 and SMS2.
21980337 SMS1 and SMS2 are capable of regulating TGN-mediated protein trafficking and secretion
21235823 direct morphological evidence for the pro-atherogenic capabilities of sphingomyelin synthase 2
20332099 Observational study of gene-disease association. (HuGE Navigator)
19454763 Data show that SMS2 acting as a bifunctional enzyme with both SM and CPE synthase activity.
19286635 Sphingomyelin synthase 2 is one of the determinants for plasma and liver sphingomyelin levels in mice.
More...

AA Sequence

MDIIETAKLEEHLENQPSDPTNTYARPAEPVEEENKNGNGKPKSLSSGLRKGTKKYPDYIQIAMPTESRN      1 - 70
KFPLEWWKTGIAFIYAVFNLVLTTVMITVVHERVPPKELSPPLPDKFFDYIDRVKWAFSVSEINGIILVG     71 - 140
LWITQWLFLRYKSIVGRRFCFIIGTLYLYRCITMYVTTLPVPGMHFQCAPKLNGDSQAKVQRILRLISGG    141 - 210
GLSITGSHILCGDFLFSGHTVTLTLTYLFIKEYSPRHFWWYHLICWLLSAAGIICILVAHEHYTIDVIIA    211 - 280
YYITTRLFWWYHSMANEKNLKVSSQTNFLSRAWWFPIFYFFEKNVQGSIPCCFSWPLSWPPGCFKSSCKK    281 - 350
YSRVQKIGEDNEKST                                                           351 - 365
//

Text Mined References (22)

PMID Year Title
25231990 2014 Sphingomyelin synthase 2, but not sphingomyelin synthase 1, is involved in HIV-1 envelope-mediated membrane fusion.
22106271 2011 Sphingomyelin and sphingomyelin synthase (SMS) in the malignant transformation of glioma cells and in 2-hydroxyoleic acid therapy.
21980337 2011 Sphingomyelin synthases regulate protein trafficking and secretion.
21235823 2011 Adenovirus-mediated sphingomyelin synthase 2 increases atherosclerotic lesions in ApoE KO mice.
20332099 2010 A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts.
19454763 2009 Sphingomyelin synthase SMS2 displays dual activity as ceramide phosphoethanolamine synthase.
19286635 2009 Sphingomyelin synthase 2 is one of the determinants for plasma and liver sphingomyelin levels in mice.
19233134 2009 Sphingomyelin synthase 2 is palmitoylated at the COOH-terminal tail, which is involved in its localization in plasma membranes.
19001565 2008 An inositolphosphorylceramide synthase is involved in regulation of plant programmed cell death associated with defense in Arabidopsis.
18694848 2008 The domain responsible for sphingomyelin synthase (SMS) activity.
More...