Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.85
PubTator Score 3.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Sertoli cell-only syndrome 37 4.223 2.1
Infertility 188 3.841 1.9
Azoospermia 110 3.27 1.6

Expression

Synonym

Accession Q8NHS9 B4DXB1 D3DTI9 J3KN63 Q969H3 Q96JT4
Symbols NYDSP20
NYD-SP20

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MKRSLNENSARSTAGCLPVPLFNQKKRNRQPLTSNPLKDDSGISTPSDNYDFPPLPTDWAWEAVNPELAP      1 - 70
VMKTVDTGQIPHSVSRPLRSQDSVFNSIQSNTGRSQGGWSYRDGNKNTSLKTWNKNDFKPQCKRTNLVAN     71 - 140
DGKNSCPVSSGAQQQKQLRIPEPPNLSRNKETELLRQTHSSKISGCTMRGLDKNSALQTLKPNFQQNQYK    141 - 210
KQMLDDIPEDNTLKETSLYQLQFKEKASSLRIISAVIESMKYWREHAQKTVLLFEVLAVLDSAVTPGPYY    211 - 280
SKTFLMRDGKNTLPCVFYEIDRELPRLIRGRVHRCVGNYDQKKNIFQCVSVRPASVSEQKTFQAFVKIAD    281 - 350
VEMQYYINVMNET                                                             351 - 363
//

Text Mined References (10)

PMID Year Title