Property Summary

NCBI Gene PubMed Count 21
PubMed Score 64.12
PubTator Score 20.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
gastric cancer 1.600 1.4e-04
group 4 medulloblastoma 1.100 5.5e-04
hepatocellular carcinoma 1.200 1.5e-07
medulloblastoma, large-cell -1.300 4.2e-04
osteosarcoma -1.737 9.9e-06
ovarian cancer -1.400 1.6e-07
progressive supranuclear palsy -1.300 2.3e-02

Pathway (1)

Protein-protein Interaction (3)

Gene RIF (11)

AA Sequence

MAGLRNESEQEPLLGDTPGSREWDILETEEHYKSRWRSIRILYLTMFLSSVGFSVVMMSIWPYLQKIDPT      1 - 70
ADTSFLGWVIASYSLGQMVASPIFGLWSNYRPRKEPLIVSILISVAANCLYAYLHIPASHNKYYMLVARG     71 - 140
LLGIGAGNVAVVRSYTAGATSLQERTSSMANISMCQALGFILGPVFQTCFTFLGEKGVTWDVIKLQINMY    141 - 210
TTPVLLSAFLGILNIILILAILREHRVDDSGRQCKSINFEEASTDEAQVPQGNIDQVAVVAINVLFFVTL    211 - 280
FIFALFETIITPLTMDMYAWTQEQAVLYNGIILAALGVEAVVIFLGVKLLSKKIGERAILLGGLIVVWVG    281 - 350
FFILLPWGNQFPKIQWEDLHNNSIPNTTFGEIIIGLWKSPMEDDNERPTGCSIEQAWCLYTPVIHLAQFL    351 - 420
TSAVLIGLGYPVCNLMSYTLYSKILGPKPQGVYMGWLTASGSGARILGPMFISQVYAHWGPRWAFSLVCG    421 - 490
IIVLTITLLGVVYKRLIALSVRYGRIQE                                              491 - 518
//

Text Mined References (25)

PMID Year Title