Property Summary

NCBI Gene PubMed Count 12
PubMed Score 5.18
PubTator Score 6.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
adult high grade glioma 3801 1.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (1)

Disease log2 FC p
adult high grade glioma -1.100 1.4e-03

Synonym

Accession Q8NHS0 B3KWV7
Symbols DJ6
CT156

Gene

PDB

2DMX  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

AA Sequence

MANYYEVLGVQASASPEDIKKAYRKLALRWHPDKNPDNKEEAEKKFKLVSEAYEVLSDSKKRSLYDRAGC      1 - 70
DSWRAGGGASTPYHSPFDTGYTFRNPEDIFREFFGGLDPFSFEFWDSPFNSDRGGRGHGLRGAFSAGFGE     71 - 140
FPAFMEAFSSFNMLGCSGGSHTTFSSTSFGGSSSGSSGFKSVMSSTEMINGHKVTTKRIVENGQERVEVE    141 - 210
EDGQLKSVTVNGKEQLKWMDSK                                                    211 - 232
//

Text Mined References (13)

PMID Year Title