Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.54
PubTator Score 6.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
adult high grade glioma 2,148

Expression

  Differential Expression (1)

Disease log2 FC p
adult high grade glioma -1.100 0.001

Gene RIF (4)

PMID Text
24450541 Taken together, the results indicate that DNAJB8 is expressed and has role in CRC CSC/CIC and that DNAJB8 is a novel target of CRC CSC/CIC-targeting immunotherapy.
23612975 The mechanism of DNAJB6 and DNAJB8 is suppression of polyQ protein aggregation by directly binding the polyQ tract.
22552285 Cancer stem-like cell (CSC) maintenance and that it offers a candidate for CSC-targeting immunotherapy in renal cell carcinoma
20159555 DNAJB6b and DNAJB8 are superior suppressors of aggregation and toxicity of disease-associated polyglutamine proteins.

AA Sequence

MANYYEVLGVQASASPEDIKKAYRKLALRWHPDKNPDNKEEAEKKFKLVSEAYEVLSDSKKRSLYDRAGC      1 - 70
DSWRAGGGASTPYHSPFDTGYTFRNPEDIFREFFGGLDPFSFEFWDSPFNSDRGGRGHGLRGAFSAGFGE     71 - 140
FPAFMEAFSSFNMLGCSGGSHTTFSSTSFGGSSSGSSGFKSVMSSTEMINGHKVTTKRIVENGQERVEVE    141 - 210
EDGQLKSVTVNGKEQLKWMDSK                                                    211 - 232
//

Text Mined References (13)

PMID Year Title
24823311 2014 Genome-wide association study of plasma N6 polyunsaturated fatty acids within the cohorts for heart and aging research in genomic epidemiology consortium.
24450541 2014 Heat shock protein DNAJB8 is a novel target for immunotherapy of colon cancer-initiating cells.
23612975 2013 The DNAJB6 and DNAJB8 protein chaperones prevent intracellular aggregation of polyglutamine peptides.
22552285 2012 HSP DNAJB8 controls tumor-initiating ability in renal cancer stem-like cells.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21231916 2011 The diverse members of the mammalian HSP70 machine show distinct chaperone-like activities.
20556630 2010 Co-chaperones are limiting in a depleted chaperone network.
20159555 2010 A DNAJB chaperone subfamily with HDAC-dependent activities suppresses toxic protein aggregation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...