Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 2.6e-07
non primary Sjogren syndrome sicca 891 1.8e-02

Synonym

Accession Q8NHR7
Symbols C15orf43

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 HCA RNA Cell Line (1)

AA Sequence

MFQGQRGWFCGSVSQDLRQFWVAEGGTISDPRAADFLFSCDASHPDTLRIYQSLDYIEDNATVFHAYYLS      1 - 70
AVANAKIKNSVALGHFILPPACLQKEIRRKIGSFIWEQDQHFLIEKHDEVTPNEIKTLRENSELATEHKK     71 - 140
ELSKSPEKHFIRTPVVEKQMYFPLQNYPVNNMVTGYISIDAMKKFLGELHDFIPGTSGYLAYHVQNEINM    141 - 210
SAIKNKLKRK                                                                211 - 220
//

Text Mined References (4)

PMID Year Title