Property Summary

NCBI Gene PubMed Count 28
PubMed Score 1506.18
PubTator Score 55.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
active ulcerative colitis -1.232 5.4e-03
colon cancer -1.200 5.8e-04
cystic fibrosis 1.251 1.5e-04
Endometriosis -1.016 2.4e-02
group 3 medulloblastoma 1.300 5.9e-03
interstitial cystitis -1.200 5.7e-03
malignant mesothelioma -2.100 2.7e-07
medulloblastoma, large-cell -1.400 5.5e-03
ovarian cancer 1.100 1.7e-05
posterior fossa group B ependymoma 1.100 1.8e-05

 GO Component (2)

Gene RIF (6)

AA Sequence

MFPVAPKPQDSSQPSDRLMTEKQQEEAEWESINVLLMMHGLKPLSLVKRTDLKDLIIFDKQSSQRMRQNL      1 - 70
KLLVEETSCQQNMIQELIETNQQLRNELQLEQSRAANQEQRANDLEQIMESVKSKIGELEDESLSRACHQ     71 - 140
QNKIKDLQKEQKTLQVKCQHYKKKRTEQEETIASLQMEVCRLKKEEEDRIVTQNRVFAYLCKRVPHTVLD    141 - 210
RQLLCLIDYYESKIRKIHTQRQYKEDESQSEEENDYRNLDASPTYKGLLMSLQNQLKESKSKIDALSSEK    211 - 280
LNLQKDLETRPTQHELRLYKQQVKKLEKALKKNVKLQELINHKKAEDTEKKDEPSKYNQQQALIDQRYFQ    281 - 350
VLCSINSIIHNPRAPVIIYKQTKGGVQNFNKDLVQDCGFEHLVPVIEMWADQLTSLKDLYKSLKTLSAEL    351 - 420
VPWLNLKKQDENEGIKVEDLLFIVDTMLEEVENKEKDSNMPHFQTLQAIVSHFQKLFDVPSLNGVYPRMN    421 - 490
EVYTRLGEMNNAVRNLQELLELDSSSSLCVLVSTVGKLCRLINEDVNEQVMQVLGPEDLQSIIYKLEEHE    491 - 560
EFFPAFQAFTNDLLEILEIDDLDAIVPAVKKLKVLSY                                     561 - 597
//

Text Mined References (29)

PMID Year Title