Property Summary

NCBI Gene PubMed Count 23
PubMed Score 1268.07
PubTator Score 55.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
sonic hedgehog group medulloblastoma 1482 2.6763137041012E-7
malignant mesothelioma 3163 2.69301961288897E-7
ovarian cancer 8492 1.74648140072417E-5
posterior fossa group B ependymoma 1530 1.78007270008176E-5
cystic fibrosis 1670 1.52864792492825E-4
colon cancer 1475 5.75798983688925E-4
active ulcerative colitis 477 0.00536836362093315
medulloblastoma, large-cell 6234 0.00547557501129991
interstitial cystitis 2299 0.00567595679379621
Endometriosis 535 0.0236497927368965

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -2.100 0.000
sonic hedgehog group medulloblastoma 1.600 0.000
cystic fibrosis 1.251 0.000
medulloblastoma, large-cell -1.400 0.005
colon cancer -1.200 0.001
active ulcerative colitis -1.232 0.005
interstitial cystitis -1.200 0.006
posterior fossa group B ependymoma 1.100 0.000
Endometriosis -1.016 0.024
ovarian cancer 1.100 0.000

Synonym

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid

Gene RIF (4)

PMID Text
26112604 findings suggest that Cep70 promotes microtubule stability by interaction with HDAC6 and regulation of tubulin acetylation
22427462 data showed that Cep70 increased the microtubule length without affecting the microtubule number in the purified system; results demonstrate that Cep70 could directly regulate microtubule assembly by promoting microtubule elongation instead of microtubule nucleation
21795687 These results thus report for the first time the identification of Cep70 as an important centrosomal protein that interacts with gamma-tubulin and underscore its critical role in the regulation of mitotic spindle assembly.
20734064 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MFPVAPKPQDSSQPSDRLMTEKQQEEAEWESINVLLMMHGLKPLSLVKRTDLKDLIIFDKQSSQRMRQNL      1 - 70
KLLVEETSCQQNMIQELIETNQQLRNELQLEQSRAANQEQRANDLEQIMESVKSKIGELEDESLSRACHQ     71 - 140
QNKIKDLQKEQKTLQVKCQHYKKKRTEQEETIASLQMEVCRLKKEEEDRIVTQNRVFAYLCKRVPHTVLD    141 - 210
RQLLCLIDYYESKIRKIHTQRQYKEDESQSEEENDYRNLDASPTYKGLLMSLQNQLKESKSKIDALSSEK    211 - 280
LNLQKDLETRPTQHELRLYKQQVKKLEKALKKNVKLQELINHKKAEDTEKKDEPSKYNQQQALIDQRYFQ    281 - 350
VLCSINSIIHNPRAPVIIYKQTKGGVQNFNKDLVQDCGFEHLVPVIEMWADQLTSLKDLYKSLKTLSAEL    351 - 420
VPWLNLKKQDENEGIKVEDLLFIVDTMLEEVENKEKDSNMPHFQTLQAIVSHFQKLFDVPSLNGVYPRMN    421 - 490
EVYTRLGEMNNAVRNLQELLELDSSSSLCVLVSTVGKLCRLINEDVNEQVMQVLGPEDLQSIIYKLEEHE    491 - 560
EFFPAFQAFTNDLLEILEIDDLDAIVPAVKKLKVLSY                                     561 - 597
//

Text Mined References (24)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26112604 2015 Cep70 regulates microtubule stability by interacting with HDAC6.
25416956 2014 A proteome-scale map of the human interactome network.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
22427462 2012 Cep70 promotes microtubule assembly in vitro by increasing microtubule elongation.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
21795687 2011 CEP70 protein interacts with ?-tubulin to localize at the centrosome and is critical for mitotic spindle assembly.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
19060904 2009 An empirical framework for binary interactome mapping.
More...