Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung cancer 4740 7.4e-04
progressive supranuclear palsy 676 1.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Rheumatic heart disease 10 3.958 2.0
Rheumatic fever 19 3.92 2.0

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer -1.200 7.4e-04
progressive supranuclear palsy -1.400 1.5e-02

Gene RIF (1)

AA Sequence

MAENHAQNKAKLISETRRRFEAEYVTDKSDKYDARDVERLQQDDNWVESYLSWRHNIVDETLKMLDESFQ      1 - 70
WRKEISVNDLNESSIPRWLLEIGVIYLHGYDKEGNKLFWIRVKYHVKDQKTILDKKKLIAFWLERYAKRE     71 - 140
NGKPVTVMFDLSETGINSIDMDFVRFIINCFKVYYPKYLSKIVIFDMPWLMNAAFKIVKTWLGPEAVSLL    141 - 210
KFTSKNEVQDYVSVEYLPPHMGGTDPFKYSYPPLVDDDFQTPLCENGPITSEDETSSKEDIESDGKETLE    211 - 280
TISNEEQTPLLKKINPTESTSKAEENEKVDSKVKAFKKPLSVFKGPLLHISPAEELYFGSTESGEKKTLI    281 - 350
VLTNVTKNIVAFKVRTTAPEKYRVKPSNSSCDPGASVDIVVSPHGGLTVSAQDRFLIMAAEMEQSSGTGP    351 - 420
AELTQFWKEVPRNKVMEHRLRCHTVESSKPNTLTLKDNAFNMSDKTSEDICLQLSRLLESNRKLEDQVQR    421 - 490
CIWFQQLLLSLTMLLLAFVTSFFYLLYS                                              491 - 518
//

Text Mined References (12)

PMID Year Title