Property Summary

NCBI Gene PubMed Count 26
Grant Count 13
R01 Count 4
Funding $1,484,060.75
PubMed Score 34.49
PubTator Score 22.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -2.295 0.000
group 4 medulloblastoma 1.600 0.000
adrenocortical carcinoma 1.147 0.001
ovarian cancer 1.200 0.001

Gene RIF (15)

PMID Text
26808549 KDM2B is an important mediator of hematopoietic cell development and has opposing roles in tumor progression that are dependent on cellular context.
26004508 The protein lysine demethylases Kdm2a and Kdm2b regulate the turnover of non-phosphorylated beta-catenin specifically within the nucleus via direct interaction with the fourth and fifth armadillo repeats.
25877602 Jhdm1b is a positive regulator of glycolysis, glutaminolysis, and pyrimidine synthesis in HeLa cells.
25273595 Low JHDM1B expression is associated with breast cancers.
25225797 the KDM2B/let-7b/EZH2 axis is involved in epigenetic regulation in MDS, with direct effects on di- and tri-methylation of H3K27.
24853546 NDY1/KDM2B functions as a master regulator of polycomb complexes and controls self-renewal of breast cancer stem cells.
23321669 KDM2B, an H3K36 histone demethylase implicated in bypass of cellular senescence and somatic cell reprogramming, is markedly overexpressed in PDAC, with levels increasing with disease grade and stage, and highest expression in metastases.
23256043 KDM2B specifically recognizes non-methylated DNA in CpG islands and recruits the polycomb repressive complex 1 (PRC1). This contributes to histone H2A lysine 119 ubiquitylation and gene repression.
22825849 a regulatory role of Fbxl10 in cell morphology, chemokine expression, and the metabolic control of fibroblasts.
22086844 It was found that JHDM1B mRNA is predominantly expressed in acute myeloid leukemia-derived aldehyde dehydrogenasehigh/CD34+ cells, and that aberrant expression of JHDM1B induces leukemia cell proliferation through modulation of cell cycle progression.
More...

AA Sequence

MAGPQMGGSAEDHPPRKRHAAEKQKKKTVIYTKCFEFESATQRPIDRQRYDENEDLSDVEEIVSVRGFSL      1 - 70
EEKLRSQLYQGDFVHAMEGKDFNYEYVQREALRVPLIFREKDGLGIKMPDPDFTVRDVKLLVGSRRLVDV     71 - 140
MDVNTQKGTEMSMSQFVRYYETPEAQRDKLYNVISLEFSHTKLEHLVKRPTVVDLVDWVDNMWPQHLKEK    141 - 210
QTEATNAIAEMKYPKVKKYCLMSVKGCFTDFHIDFGGTSVWYHVFRGGKIFWLIPPTLHNLALYEEWVLS    211 - 280
GKQSDIFLGDRVERCQRIELKQGYTFFIPSGWIHAVYTPVDSLVFGGNILHSFNVPMQLRIYEIEDRTRV    281 - 350
QPKFRYPFYYEMCWYVLERYVYCVTQRSHLTQEYQRESMLIDAPRKPSIDGFSSDSWLEMEEEACDQQPQ    351 - 420
EEEEKDEEGEGRDRAPKPPTDGSTSPTSTPSEDQEALGKKPKAPALRFLKRTLSNESEESVKSTTLAVDY    421 - 490
PKTPTGSPATEVSAKWTHLTEFELKGLKALVEKLESLPENKKCVPEGIEDPQALLEGVKNVLKEHADDDP    491 - 560
SLAITGVPVVTWPKKTPKNRAVGRPKGKLGPASAVKLAANRTTAGARRRRTRCRKCEACLRTECGECHFC    561 - 630
KDMKKFGGPGRMKQSCIMRQCIAPVLPHTAVCLVCGEAGKEDTVEEEEGKFNLMLMECSICNEIIHPGCL    631 - 700
KIKESEGVVNDELPNCWECPKCNHAGKTGKQKRGPGFKYASNLPGSLLKEQKMNRDNKEGQEPAKRRSEC    701 - 770
EEAPRRRSDEHSKKVPPDGLLRRKSDDVHLRKKRKYEKPQELSGRKRASSLQTSPGSSSHLSPRPPLGSS    771 - 840
LSPWWRSSLTYFQQQLKPGKEDKLFRKKRRSWKNAEDRMALANKPLRRFKQEPEDELPEAPPKTRESDHS    841 - 910
RSSSPTAGPSTEGAEGPEEKKKVKMRRKRRLPNKELSRELSKELNHEIQRTENSLANENQQPIKSEPESE    911 - 980
GEEPKRPPGICERPHRFSKGLNGTPRELRHQLGPSLRSPPRVISRPPPSVSPPKCIQMERHVIRPPPISP    981 - 1050
PPDSLPLDDGAAHVMHREVWMAVFSYLSHQDLCVCMRVCRTWNRWCCDKRLWTRIDLNHCKSITPLMLSG   1051 - 1120
IIRRQPVSLDLSWTNISKKQLSWLINRLPGLRDLVLSGCSWIAVSALCSSSCPLLRTLDVQWVEGLKDAQ   1121 - 1190
MRDLLSPPTDNRPGQMDNRSKLRNIVELRLAGLDITDASLRLIIRHMPLLSKLHLSYCNHVTDQSINLLT   1191 - 1260
AVGTTTRDSLTEINLSDCNKVTDQCLSFFKRCGNICHIDLRYCKQVTKEGCEQFIAEMSVSVQFGQVEEK   1261 - 1330
LLQKLS                                                                   1331 - 1336
//

Text Mined References (38)

PMID Year Title
26808549 2016 Histone demethylase KDM2B regulates lineage commitment in normal and malignant hematopoiesis.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26004508 2015 Kdm2a/b Lysine Demethylases Regulate Canonical Wnt Signaling by Modulating the Stability of Nuclear ?-Catenin.
25877602 2015 A systematic study of the cellular metabolic regulation of Jhdm1b in tumor cells.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25273595 2015 JHDM1B expression regulates ribosome biogenesis and cancer cell growth in a p53 dependent manner.
25225797 2014 The KDM2B- let-7b -EZH2 axis in myelodysplastic syndromes as a target for combined epigenetic therapy.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24853546 2014 NDY1/KDM2B functions as a master regulator of polycomb complexes and controls self-renewal of breast cancer stem cells.
More...