Property Summary

NCBI Gene PubMed Count 8
PubMed Score 510.97
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Gene RIF (2)

PMID Text
17598925 Although we did not observe an association between the TRY6 deletion polymorphism and breast cancer risk, the identification and investigation of further deletions using the present approach may help to elucidate their effect on disease susceptibility
11702203 The integration of genomic, transcriptomic, proteomic, and disease-association data suggested that TRY6 may represent a transition state between a functioning duplicated gene and a nonfunctional pseudogene, that is, an expressed pseudogene.

AA Sequence

MNPLLILAFVGAAVAVPFDDDDKIVGGYTCEENSVPYQVSLNSGSHFCGGSLISEQWVVSAGHCYKPHIQ      1 - 70
VRLGEHNIEVLEGNEQFINAAKIIRHPKYNRIILNNDIMLIKLSTPAVINAHVSTISLPTAPPAAGTECL     71 - 140
ISGWGNTLSSGADYPDELQCLDAPVLTQAKCKASYPLKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQL    141 - 210
QGIVSWGYGCAQKRRPGVYTKVYNYVDWIKDTIAANS                                     211 - 247
//

Text Mined References (9)

PMID Year Title
25546417 2015 Gene conversion between cationic trypsinogen (PRSS1) and the pseudogene trypsinogen 6 (PRSS3P2) in patients with chronic pancreatitis.
17598925 2007 High-throughput genotyping of a common deletion polymorphism disrupting the TRY6 gene and its association with breast cancer risk.
15313892 2004 S100 family members and trypsinogens are predictors of distant metastasis and survival in early-stage non-small cell lung cancer.
12853948 2003 The DNA sequence of human chromosome 7.
11702203 2001 Molecular pathology and evolutionary and physiological implications of pancreatitis-associated cationic trypsinogen mutations.
11073713 2000 Gene conversion-like missense mutations in the human cationic trypsinogen gene and insights into the molecular evolution of the human trypsinogen family.
10881933 2000 Genes, cloned cDNAs, and proteins of human trypsinogens and pancreatitis-associated cationic trypsinogen mutations.
9732462 1998 The origin of trypsin: evidence for multiple gene duplications in trypsins.
8650574 1996 The complete 685-kilobase DNA sequence of the human beta T cell receptor locus.