Property Summary

NCBI Gene PubMed Count 8
PubMed Score 549.45
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Gene RIF (2)

AA Sequence

MNPLLILAFVGAAVAVPFDDDDKIVGGYTCEENSVPYQVSLNSGSHFCGGSLISEQWVVSAGHCYKPHIQ      1 - 70
VRLGEHNIEVLEGNEQFINAAKIIRHPKYNRIILNNDIMLIKLSTPAVINAHVSTISLPTAPPAAGTECL     71 - 140
ISGWGNTLSSGADYPDELQCLDAPVLTQAKCKASYPLKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQL    141 - 210
QGIVSWGYGCAQKRRPGVYTKVYNYVDWIKDTIAANS                                     211 - 247
//

Text Mined References (9)

PMID Year Title