Property Summary

NCBI Gene PubMed Count 24
PubMed Score 0.00
PubTator Score 3.58

Knowledge Summary

Patent

No data available

Gene RIF (19)

AA Sequence

MSLMVISMACVGFFLLQGAWTHEGGQDKPLLSAWPSAVVPRGGHVTLLCRSRLGFTIFSLYKEDGVPVPE      1 - 70
LYNKIFWKSILMGPVTPAHAGTYRCRGSHPRSPIEWSAPSNPLVIVVTGLFGKPSLSAQPGPTVRTGENV     71 - 140
ALSCSSRSSFDMYHLSREGRAHEPRLPAVPSVDGTFQADFPLGPATHGGTYTCFSSLHDSPYEWSDPSDP    141 - 210
LLVSVTGNSSSSSSSPTEPSSKTGIRRHLHILIGTSVAIILFIILFFFLLHCCCSNKKNAAVMDQGPAGD    211 - 280
RTVNREDSDDQDPQEVTYAQLDHCVFTQTKITSPSQRPKTPPTDTTMYMELPNAKPRSLSPAHKHHSQAL    281 - 350
RGSSRETTALSQNRVASSHVPAAGI                                                 351 - 375
//

Text Mined References (24)

PMID Year Title