Property Summary

NCBI Gene PubMed Count 52
Grant Count 13
R01 Count 4
Funding $1,026,416.4
PubMed Score 47.75
PubTator Score 56.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Gene RIF (21)

PMID Text
26678451 Identification of ILT4 as a cellular receptor for CSP C4d
25551576 involvement of ILT3 and ILT4 in the modulation of immune responsiveness in multiple sclerosis by both interferon and vitamin D
22664025 Cyclosporine up-regulated the expression of ILT3 and ILT4 on natural killer cells, which influenced their cytotoxicity against tumor cells.
22387553 ILT3Fc inhibits T cell activation and induces the generation of suppressor T cells targeting multiple inflammatory miRNA pathways.
21454581 Crystal structure of leukocyte Ig-like receptor LILRB4 (ILT3/LIR-5/CD85k): a myeloid inhibitory receptor involved in immune tolerance.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19860908 upregulated on antigen-presenting cells in response to Salmonella infection
19833736 Data show that LILRB4 is a potent inhibitor of monocyte activation via FcgammaRI.
19535644 A tryptophan-deprived environment generates monocyte-derived dendritic cells with a marked up-regulation of inhibitory receptors ILT3 and ILT4 and enhanced capacity to induce CD4+CD25+Foxp3+ regulatory T cells in an ILT3-dependent manner.
19380766 ILT3 may play a critical role in the control of inflammation.
More...

AA Sequence

MIPTFTALLCLGLSLGPRTHMQAGPLPKPTLWAEPGSVISWGNSVTIWCQGTLEAREYRLDKEESPAPWD      1 - 70
RQNPLEPKNKARFSIPSMTEDYAGRYRCYYRSPVGWSQPSDPLELVMTGAYSKPTLSALPSPLVTSGKSV     71 - 140
TLLCQSRSPMDTFLLIKERAAHPLLHLRSEHGAQQHQAEFPMSPVTSVHGGTYRCFSSHGFSHYLLSHPS    141 - 210
DPLELIVSGSLEDPRPSPTRSVSTAAGPEDQPLMPTGSVPHSGLRRHWEVLIGVLVVSILLLSLLLFLLL    211 - 280
QHWRQGKHRTLAQRQADFQRPPGAAEPEPKDGGLQRRSSPAADVQGENFCAAVKNTQPEDGVEMDTRQSP    281 - 350
HDEDPQAVTYAKVKHSRPRREMASPPSPLSGEFLDTKDRQAEEDRQMDTEAAASEAPQDVTYAQLHSFTL    351 - 420
RQKATEPPPSQEGASPAEPSVYATLAIH                                              421 - 448
//

Text Mined References (54)

PMID Year Title
26678451 2016 Ig-like transcript 4 as a cellular receptor for soluble complement fragment C4d.
25551576 2014 Interferon beta and vitamin D synergize to induce immunoregulatory receptors on peripheral blood monocytes of multiple sclerosis patients.
25187353 2014 Clozapine-induced agranulocytosis is associated with rare HLA-DQB1 and HLA-B alleles.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23666960 2013 Plasmacytoid dendritic cells in patients with autoimmune thyroid disease.
23616249 2013 Mesenchymal stem cells from periapical lesions modulate differentiation and functional properties of monocyte-derived dendritic cells.
23607934 2013 Lost therapeutic potential of monocyte-derived dendritic cells through lost tissue homing: stable restoration of gut specificity with retinoic acid.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
More...