Property Summary

NCBI Gene PubMed Count 56
PubMed Score 49.27
PubTator Score 56.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
cutaneous lupus erythematosus 2.200 1.7e-03
head and neck cancer and chronic obstruc... 1.100 8.6e-04
interstitial cystitis 1.600 1.4e-03
invasive ductal carcinoma 1.012 4.4e-04
lung carcinoma -1.100 9.0e-07
osteosarcoma -1.103 3.5e-02
psoriasis 1.300 2.8e-33
tuberculosis and treatment for 6 months -1.300 3.3e-04

Gene RIF (25)

AA Sequence

MIPTFTALLCLGLSLGPRTHMQAGPLPKPTLWAEPGSVISWGNSVTIWCQGTLEAREYRLDKEESPAPWD      1 - 70
RQNPLEPKNKARFSIPSMTEDYAGRYRCYYRSPVGWSQPSDPLELVMTGAYSKPTLSALPSPLVTSGKSV     71 - 140
TLLCQSRSPMDTFLLIKERAAHPLLHLRSEHGAQQHQAEFPMSPVTSVHGGTYRCFSSHGFSHYLLSHPS    141 - 210
DPLELIVSGSLEDPRPSPTRSVSTAAGPEDQPLMPTGSVPHSGLRRHWEVLIGVLVVSILLLSLLLFLLL    211 - 280
QHWRQGKHRTLAQRQADFQRPPGAAEPEPKDGGLQRRSSPAADVQGENFCAAVKNTQPEDGVEMDTRQSP    281 - 350
HDEDPQAVTYAKVKHSRPRREMASPPSPLSGEFLDTKDRQAEEDRQMDTEAAASEAPQDVTYAQLHSFTL    351 - 420
RQKATEPPPSQEGASPAEPSVYATLAIH                                              421 - 448
//

Text Mined References (58)

PMID Year Title