Property Summary

NCBI Gene PubMed Count 12
Grant Count 2
Funding $413,564.19
PubMed Score 14.02
PubTator Score 8.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
psoriasis -1.700 0.000
osteosarcoma -1.728 0.000
atypical teratoid / rhabdoid tumor -1.300 0.000
glioblastoma -1.300 0.000
primary pancreatic ductal adenocarcinoma 1.052 0.020
Breast cancer 2.600 0.026
subependymal giant cell astrocytoma -1.497 0.040
invasive ductal carcinoma -1.043 0.012
nasopharyngeal carcinoma 1.200 0.012
Pick disease -1.100 0.002
dermatomyositis -1.100 0.003

Synonym

Accession Q8NHH9 B7Z1X2 B7Z7X8 Q4ZG30 Q7Z630 Q8NHH8 Q9H5M7
Symbols aip-2
ARL3IP2
ARL6IP2
atlastin2

Gene

 Grant Application (2)

Gene RIF (3)

PMID Text
25773277 These results suggest that the three ATLs have different capacities to mediate endoplasmic reticulum fusion, with ATL1 being the strongest and ATL3 being the weakest.
22065636 The role of GTP hydrolysis in the ATL2 fusion mechanism also needs to be tempered by the uncertainty of whether the behavior of the ATL2 soluble domain, observed herein, reflects the behavior of the full-length, membrane-anchored protein.
18270207 A family of human GTPases, atlastin-2 and -3 that are closely related to atlastin-1 are described.

AA Sequence

MAEGDEAARGQQPHQGLWRRRRTSDPSAAVNHVSSTTSLGENYEDDDLVNSDEVMKKPCPVQIVLAHEDD      1 - 70
HNFELDEEALEQILLQEHIRDLNIVVVSVAGAFRKGKSFLLDFMLRYMYNKDSQSWIGGNNEPLTGFTWR     71 - 140
GGCERETTGIQVWNEVFVIDRPNGTKVAVLLMDTQGAFDSQSTIKDCATVFALSTMTSSVQVYNLSQNIQ    141 - 210
EDDLQHLQLFTEYGRLAMEEIYQKPFQTLMFLIRDWSYPYEHSYGLEGGKQFLEKRLQVKQNQHEELQNV    211 - 280
RKHIHNCFSNLGCFLLPHPGLKVATNPSFDGRLKDIDEDFKRELRNLVPLLLAPENLVEKEISGSKVTCR    281 - 350
DLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVAGARDTYCKSMEQVCGGDKPYIAPSDLERKHLD    351 - 420
LKEVAIKQFRSVKKMGGDEFCRRYQDQLEAEIEETYANFIKHNDGKNIFYAARTPATLFAVMFAMYIISG    421 - 490
LTGFIGLNSIAVLCNLVMGLALIFLCTWAYVKYSGEFREIGTVIDQIAETLWEQVLKPLGDNLMEENIRQ    491 - 560
SVTNSIKAGLTDQVSHHARLKTD                                                   561 - 583
//

Text Mined References (23)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25773277 2015 Human atlastin GTPases mediate differentiated fusion of endoplasmic reticulum membranes.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23969831 2013 Protrudin binds atlastins and endoplasmic reticulum-shaping proteins and regulates network formation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22065636 2011 An intramolecular salt bridge drives the soluble domain of GTP-bound atlastin into the postfusion conformation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
More...