Property Summary

NCBI Gene PubMed Count 12
PubMed Score 14.02
PubTator Score 8.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
psoriasis -1.700 5.9e-05
osteosarcoma -1.728 1.5e-06
atypical teratoid / rhabdoid tumor -1.300 1.4e-04
glioblastoma -1.300 2.1e-06
primary pancreatic ductal adenocarcinoma 1.052 2.0e-02
Breast cancer 2.600 2.6e-02
subependymal giant cell astrocytoma -1.497 4.0e-02
invasive ductal carcinoma -1.043 1.2e-02
nasopharyngeal carcinoma 1.200 1.2e-02
Pick disease -1.100 1.9e-03
dermatomyositis -1.100 3.0e-03

Gene RIF (3)

PMID Text
25773277 These results suggest that the three ATLs have different capacities to mediate endoplasmic reticulum fusion, with ATL1 being the strongest and ATL3 being the weakest.
22065636 The role of GTP hydrolysis in the ATL2 fusion mechanism also needs to be tempered by the uncertainty of whether the behavior of the ATL2 soluble domain, observed herein, reflects the behavior of the full-length, membrane-anchored protein.
18270207 A family of human GTPases, atlastin-2 and -3 that are closely related to atlastin-1 are described.

AA Sequence

MAEGDEAARGQQPHQGLWRRRRTSDPSAAVNHVSSTTSLGENYEDDDLVNSDEVMKKPCPVQIVLAHEDD      1 - 70
HNFELDEEALEQILLQEHIRDLNIVVVSVAGAFRKGKSFLLDFMLRYMYNKDSQSWIGGNNEPLTGFTWR     71 - 140
GGCERETTGIQVWNEVFVIDRPNGTKVAVLLMDTQGAFDSQSTIKDCATVFALSTMTSSVQVYNLSQNIQ    141 - 210
EDDLQHLQLFTEYGRLAMEEIYQKPFQTLMFLIRDWSYPYEHSYGLEGGKQFLEKRLQVKQNQHEELQNV    211 - 280
RKHIHNCFSNLGCFLLPHPGLKVATNPSFDGRLKDIDEDFKRELRNLVPLLLAPENLVEKEISGSKVTCR    281 - 350
DLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVAGARDTYCKSMEQVCGGDKPYIAPSDLERKHLD    351 - 420
LKEVAIKQFRSVKKMGGDEFCRRYQDQLEAEIEETYANFIKHNDGKNIFYAARTPATLFAVMFAMYIISG    421 - 490
LTGFIGLNSIAVLCNLVMGLALIFLCTWAYVKYSGEFREIGTVIDQIAETLWEQVLKPLGDNLMEENIRQ    491 - 560
SVTNSIKAGLTDQVSHHARLKTD                                                   561 - 583
//

Text Mined References (23)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25773277 2015 Human atlastin GTPases mediate differentiated fusion of endoplasmic reticulum membranes.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23969831 2013 Protrudin binds atlastins and endoplasmic reticulum-shaping proteins and regulates network formation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22065636 2011 An intramolecular salt bridge drives the soluble domain of GTP-bound atlastin into the postfusion conformation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19665976 2009 A class of dynamin-like GTPases involved in the generation of the tubular ER network.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18270207 2008 Atlastin GTPases are required for Golgi apparatus and ER morphogenesis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14506257 2003 Cellular localization, oligomerization, and membrane association of the hereditary spastic paraplegia 3A (SPG3A) protein atlastin.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10508919 1999 A novel ADP-ribosylation like factor (ARL-6), interacts with the protein-conducting channel SEC61beta subunit.
10409428 1999 Gene expression in proliferating human erythroid cells.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.