Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.70
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
juvenile dermatomyositis 1,189

Expression

  Differential Expression (1)

Disease log2 FC p
juvenile dermatomyositis 1.020 0.000

Synonym

Accession Q8NHH1 F8W6M1
Symbols C9orf20
bA244O19.1

Gene

Gene RIF (2)

PMID Text
20583170 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAAAASVTGRVTWAASPMRSLGLGRRLSLPGPRLDAVTAAVNPSLSDHGNGLGRGTRGSGCSGGSLVADW      1 - 70
GGGAAAAAAVALALAPALSTMRRGSSESELAARWEAEAVAAAKAAAKAEAEATAETVAEQVRVDAGAAGE     71 - 140
PECKAGEEQPKVLAPAPAQPSAAEEGNTQVLQRPPPTLPPSKPKPVQGLCPHGKPRDKGRSCKRSSGHGS    141 - 210
GENGSQRPVTVDSSKARTSLDALKISIRQLKWKEFPFGRRLPCDIYWHGVSFHDNDIFSGQVNKFPGMTE    211 - 280
MVRKITLSRAVRTMQNLFPEEYNFYPRSWILPDEFQLFVAQVQMVKDDDPSWKPTFIVKPDGGCQGDGIY    281 - 350
LIKDPSDIRLAGTLQSRPAVVQEYICKPLLIDKLKFDIRLYVLLKSLDPLEIYIAKDGLSRFCTEPYQEP    351 - 420
TPKNLHRIFMHLTNYSLNIHSGNFIHSDSASTGSKRTFSSILCRLSSKGVDIKKVWSDIISVVIKTVIAL    421 - 490
TPELKVFYQSDIPTGRPGPTCFQILGFDILLMKNLKPILLEVNANPSMRIEHEHELSPGVFENVPSLVDE    491 - 560
EVKVAVIRDTLRLMDPLKKKRENQSQQLEKPFAGKEDALDGELTSAPDCNANPEAHLPSICLKQVFPKYA    561 - 630
KQFNYLRLVDRMANLFIRFLGIKGTMKLGPTGFRTFIRSCKLSSSSLSMAAVDILYIDITRRWNSMTLDQ    631 - 700
RDSGMCLQAFVEAFFFLAQRKFKMLPLHEQVASLIDLCEYHLSLLDEKRLVCGRGVPSGGRPPHRGPPQE    701 - 770
PSPSAQPAGDNPPPRTSCANKLSHPRHTLS                                            771 - 800
//

Text Mined References (11)

PMID Year Title
25959773 2015 Multivalent Microtubule Recognition by Tubulin Tyrosine Ligase-like Family Glutamylases.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
22699663 2012 Genome-wide association study of periodontal pathogen colonization.
22493317 2012 CSAP localizes to polyglutamylated microtubules and promotes proper cilia function and zebrafish development.
20583170 2010 Follow-up association studies of chromosome region 9q and nonsyndromic cleft lip/palate.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15890843 2005 Tubulin polyglutamylase enzymes are members of the TTL domain protein family.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...