Property Summary

NCBI Gene PubMed Count 6
Grant Count 2
Funding $176,906
PubMed Score 2.48
PubTator Score 1.76

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.647 0.002
sonic hedgehog group medulloblastoma 1.400 0.000
ductal carcinoma in situ 1.400 0.000

Synonym

Accession Q8NHG8
Symbols RNF202

Gene

 Grant Application (2)

Gene RIF (2)

PMID Text
22797923 ZNRF1 and ZNRF2 are new players in regulation of the ubiquitous Na(+)/K(+)ATPase that is tuned to changing demands in many physiological contexts.
14561866 identification of ZNRF2; data suggest that ZNRF proteins play a role in the establishment and maintenance of neuronal transmission and plasticity via their ubiquitin ligase activity [ZNRF2]

AA Sequence

MGAKQSGPAAANGRTRAYSGSDLPSSSSGGANGTAGGGGGARAAAAGRFPAQVPSAHQPSASGGAAAAAA      1 - 70
APAAPAAPRSRSLGGAVGSVASGARAAQSPFSIPNSSSGPYGSQDSVHSSPEDGGGGRDRPVGGSPGGPR     71 - 140
LVIGSLPAHLSPHMFGGFKCPVCSKFVSSDEMDLHLVMCLTKPRITYNEDVLSKDAGECAICLEELQQGD    141 - 210
TIARLPCLCIYHKGCIDEWFEVNRSCPEHPSD                                          211 - 242
//

Text Mined References (14)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22797923 2012 ZNRF2 is released from membranes by growth factors and, together with ZNRF1, regulates the Na+/K+ATPase.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19028597 2009 Maturation of human dendritic cells is accompanied by functional remodelling of the ubiquitin-proteasome system.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
More...