Property Summary

NCBI Gene PubMed Count 14
Grant Count 4
R01 Count 2
Funding $227,582.35
PubMed Score 4.07
PubTator Score 5.88

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8NHG7
Symbols

Gene

Gene RIF (4)

PMID Text
24100225 the interactions between P97 and these motifs, including VCP-binding motif (VBM) and VCP-interacting motif (VIM). The solution structures of the VBM motif from HRD1 and the VIM motif from SVIP are both comprised mainly of a single alpha-helix.
24055875 A major portion of SVIP is intrinsically disordered in solution.
21909394 SVIP plays a regulatory role in p97 subcellular localization and is a novel regulator of autophagy.
17872946 SVIP is an endogenous inhibitor of ERAD that acts through regulating the assembly of the gp78-p97/VCP-Derlin1 complex.

AA Sequence

MGLCFPCPGESAPPTPDLEEKRAKLAEAAERRQKEAASRGILDVQSVQEKRKKKEKIEKQIATSGPPPEG      1 - 70
GLRWTVS                                                                    71 - 77
//

Text Mined References (17)

PMID Year Title
25660456 2015 Identification of ERAD components essential for dislocation of the null Hong Kong variant of ?-1-antitrypsin (NHK).
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
25085501 2014 Integrated genome-wide association, coexpression network, and expression single nucleotide polymorphism analysis identifies novel pathway in allergic rhinitis.
24100225 2013 Structural and mechanistic insights into the arginine/lysine-rich peptide motifs that interact with P97/VCP.
24055875 2013 Structure and expression of a novel compact myelin protein - small VCP-interacting protein (SVIP).
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21909394 2011 SVIP induces localization of p97/VCP to the plasma and lysosomal membranes and regulates autophagy.
21896481 2011 The general definition of the p97/valosin-containing protein (VCP)-interacting motif (VIM) delineates a new family of p97 cofactors.
21546767 2011 Genome-wide association scan for survival on dialysis in African-Americans with type 2 diabetes.
More...