Property Summary

NCBI Gene PubMed Count 15
PubMed Score 4.96
PubTator Score 5.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
active Crohn's disease 1.024 9.0e-03
adult high grade glioma -1.300 4.2e-03
astrocytic glioma -2.800 1.4e-02
Astrocytoma, Pilocytic -1.200 1.2e-04
Atopic dermatitis -1.200 1.7e-04
atypical teratoid / rhabdoid tumor -1.400 2.5e-03
ductal carcinoma in situ 1.600 2.4e-03
ependymoma -2.700 4.3e-02
glioblastoma -1.200 2.2e-04
group 4 medulloblastoma -1.700 5.6e-05
intraductal papillary-mucinous adenoma (... 1.100 1.4e-04
intraductal papillary-mucinous carcinoma... 1.200 4.0e-02
invasive ductal carcinoma 1.600 1.5e-02
lung carcinoma 2.200 3.1e-24
medulloblastoma, large-cell 1.200 1.9e-05
non primary Sjogren syndrome sicca 1.500 2.6e-02
oligodendroglioma -2.600 3.5e-02
osteosarcoma -1.935 1.2e-03
ovarian cancer -1.200 2.9e-04
Pick disease -1.500 7.3e-03
primitive neuroectodermal tumor -2.000 2.1e-02
psoriasis -1.100 7.7e-25
subependymal giant cell astrocytoma -1.550 1.6e-02

Gene RIF (5)

AA Sequence

MGLCFPCPGESAPPTPDLEEKRAKLAEAAERRQKEAASRGILDVQSVQEKRKKKEKIEKQIATSGPPPEG      1 - 70
GLRWTVS                                                                    71 - 77
//

Text Mined References (18)

PMID Year Title