Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.40
PubTator Score 2.50

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.400 2.2e-06
cystic fibrosis -1.395 6.9e-05
group 3 medulloblastoma -1.200 4.3e-04
lung carcinoma 1.400 1.6e-33
medulloblastoma, large-cell -1.500 7.8e-04
ovarian cancer 1.100 2.4e-03
psoriasis -1.400 6.0e-08
tuberculosis 1.200 1.6e-05

Protein-protein Interaction (1)

Gene RIF (1)

AA Sequence

MTAHSFALPVIIFTTFWGLVGIAGPWFVPKGPNRGVIITMLVATAVCCYLFWLIAILAQLNPLFGPQLKN      1 - 70
ETIWYVRFLWE                                                                71 - 81
//

Text Mined References (10)

PMID Year Title