Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.40
PubTator Score 2.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 1.61378044353514E-33
atypical teratoid/rhabdoid tumor 1095 1.67745575054027E-8
psoriasis 6685 6.02179807077156E-8
tuberculosis 1563 1.62258344526147E-5
cystic fibrosis 1670 6.85727584177331E-5
ovarian cancer 8492 3.36855472379629E-4
group 3 medulloblastoma 2254 4.29584007311308E-4
medulloblastoma, large-cell 6234 7.83274692314999E-4

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -1.400 0.000
cystic fibrosis -1.395 0.000
atypical teratoid/rhabdoid tumor -1.500 0.000
medulloblastoma, large-cell -1.500 0.001
tuberculosis 1.200 0.000
group 3 medulloblastoma -1.200 0.000
lung carcinoma 1.400 0.000
ovarian cancer 1.400 0.000

Synonym

Gene

  Ortholog (5)

Species Source
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG

Gene RIF (1)

PMID Text
17350184 The identification of this novel form of the e-subunit lends further support to the hypothesis that subunit differences may play a key role in the structure, site and function of H(+)-ATPases within the cell.[ATPV0E2]

AA Sequence

MTAHSFALPVIIFTTFWGLVGIAGPWFVPKGPNRGVIITMLVATAVCCYLFWLIAILAQLNPLFGPQLKN      1 - 70
ETIWYVRFLWE                                                                71 - 81
//

Text Mined References (10)

PMID Year Title
22982048 2012 Lipofuscin is formed independently of macroautophagy and lysosomal activity in stress-induced prematurely senescent human fibroblasts.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17662945 2007 Coupling of rotation and catalysis in F(1)-ATPase revealed by single-molecule imaging and manipulation.
17350184 2007 Molecular cloning and characterization of a novel form of the human vacuolar H+-ATPase e-subunit: an essential proton pump component.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9847074 1998 Toward a complete human genome sequence.
2874839 1986 Receptor-mediated endocytosis: the intracellular journey of transferrin and its receptor.