Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.40
PubTator Score 2.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -1.400 0.000
cystic fibrosis -1.395 0.000
atypical teratoid/rhabdoid tumor -1.500 0.000
medulloblastoma, large-cell -1.500 0.001
tuberculosis 1.200 0.000
group 3 medulloblastoma -1.200 0.000
lung carcinoma 1.400 0.000
ovarian cancer 1.400 0.000

Gene RIF (1)

PMID Text
17350184 The identification of this novel form of the e-subunit lends further support to the hypothesis that subunit differences may play a key role in the structure, site and function of H(+)-ATPases within the cell.[ATPV0E2]

AA Sequence

MTAHSFALPVIIFTTFWGLVGIAGPWFVPKGPNRGVIITMLVATAVCCYLFWLIAILAQLNPLFGPQLKN      1 - 70
ETIWYVRFLWE                                                                71 - 81
//

Text Mined References (10)

PMID Year Title
22982048 2012 Lipofuscin is formed independently of macroautophagy and lysosomal activity in stress-induced prematurely senescent human fibroblasts.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17662945 2007 Coupling of rotation and catalysis in F(1)-ATPase revealed by single-molecule imaging and manipulation.
17350184 2007 Molecular cloning and characterization of a novel form of the human vacuolar H+-ATPase e-subunit: an essential proton pump component.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9847074 1998 Toward a complete human genome sequence.
2874839 1986 Receptor-mediated endocytosis: the intracellular journey of transferrin and its receptor.