Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.14
PubTator Score 0.17

Knowledge Summary

Patent (110)

TINX Plot

  Disease Sources (2)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Central neurocytoma 1 4.642 2.3

AA Sequence

MPNSTTVMEFLLMRFSDVWTLQILHSASFFMLYLVTLMGNILIVTVTTCDSSLHMPMYFFLRNLSILDAC      1 - 70
YISVTVPTSCVNSLLDSTTISKAGCVAQVFLVVFFVYVELLFLTIMAHDRYVAVCQPLHYPVIVNSRICI     71 - 140
QMTLASLLSGLVYAGMHTGSTFQLPFCRSNVIHQFFCDIPSLLKLSCSDTFSNEVMIVVSALGVGGGCFI    141 - 210
FIIRSYIHIFSTVLGFPRGADRTKAFSTCIPHILVVSVFLSSCSSVYLRPPAIPAATQDLILSGFYSIMP    211 - 280
PLFNPIIYSLRNKQIKVAIKKIMKRIFYSENV                                          281 - 312
//

Text Mined References (2)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
14983052 2004 The human olfactory receptor gene family.