Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.71
PubTator Score 32.58

Knowledge Summary

Patent (309)

Synonym

Accession Q8NHC4 B9EH35 Q6IFH2
Symbols OR1-28

Gene

PANTHER Protein Class (2)

Gene RIF (1)

PMID Text
25791473 data demonstrate the physiological role of OR10J5 in angiogenesis and represent roles of ORs in HUVEC cells

AA Sequence

MKRKNFTEVSEFIFLGFSSFGKHQITLFVVFLTVYILTLVANIIIVTIICIDHHLHTPMYFFLSMLASSE      1 - 70
TVYTLVIVPRMLLSLIFHNQPISLAGCATQMFFFVILATNNCFLLTAMGYDRYVAICRPLRYTVIMSKGL     71 - 140
CAQLVCGSFGIGLTMAVLHVTAMFNLPFCGTVVDHFFCDIYPVMKLSCIDTTINEIINYGVSSFVIFVPI    141 - 210
GLIFISYVLVISSILQIASAEGRKKTFATCVSHLTVVIVHCGCASIAYLKPKSESSIEKDLVLSVTYTII    211 - 280
TPLLNPVVYSLRNKEVKDALCRVVGRNIS                                             281 - 309
//

Text Mined References (9)

PMID Year Title
25791473 2015 Expression of human olfactory receptor 10J5 in heart aorta, coronary artery, and endothelial cells and its functional role in angiogenesis.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22939635 2012 Genome-wide association and population genetic analysis of C-reactive protein in African American and Hispanic American women.
17903294 2007 Genome-wide association and linkage analyses of hemostatic factors and hematological phenotypes in the Framingham Heart Study.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12908129 2003 Natural selection on the olfactory receptor gene family in humans and chimpanzees.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.