Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 49.52

Knowledge Summary

Patent (114)


Accession Q8NHB8 B2RN70 Q6IF47
Symbols OR3-9


  Ortholog (2)

Species Source
Mouse OMA Inparanoid
Cow OMA Inparanoid

AA Sequence

VVPLLNPFIYSLRNKEVISVLRKILLKIKSQGSVNK                                      281 - 316

Text Mined References (4)

PMID Year Title
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.