Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 49.52

Knowledge Summary

Patent (114)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

AA Sequence

MVEENHTMKNEFILTGFTDHPELKTLLFVVFFAIYLITVVGNISLVALIFTHCRLHTPMYIFLGNLALVD      1 - 70
SCCACAITPKMLENFFSEGKRISLYECAVQFYFLCTVETADCFLLAAVAYDRYVAICNPLQYHIMMSKKL     71 - 140
CIQMTTGAFIAGNLHSMIHVGLVFRLVFCGLNHINHFYCDTLPLYRLSCVDPFINELVLFIFSGSVQVFT    141 - 210
IGSVLISYLYILLTIFRMKSKEGRAKAFSTCASHFSSVSLFYGSIFFLYIRPNLLEEGGNDIPAAILFTI    211 - 280
VVPLLNPFIYSLRNKEVISVLRKILLKIKSQGSVNK                                      281 - 316
//

Text Mined References (4)

PMID Year Title