Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.13
PubTator Score 52.82

Knowledge Summary

Patent (640)

TINX Plot

  Disease (3)

Disease Target Count P-value
non primary Sjogren syndrome sicca 891 2.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Autosomal recessive congenital ichthyosis 11 10 4.451 2.2

AA Sequence

MAEENHTMKNEFILTGFTDHPELKTLLFVVFFAIYLITVVGNISLVALIFTHRRLHTPMYIFLGNLALVD      1 - 70
SCCACAITPKMLENFFSENKRISLYECAVQFYFLCTVETADCFLLAAMAYDRYVAICNPLQYHIMMSKKL     71 - 140
CIQMTTGAFIAGNLHSMIHVGLVFRLVFCGSNHINHFYCDILPLYRLSCVDPYINELVLFIFSGSVQVFT    141 - 210
IGSVLISYLYILLTIFKMKSKEGRAKAFSTCASHFLSVSLFYGSLFFMYVRPNLLEEGDKDIPAAILFTI    211 - 280
VVPLLNPFIYSLRNREVISVLRKILMKK                                              281 - 308
//

Text Mined References (5)

PMID Year Title