Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent (92)

AA Sequence

MGRWVNQSYTDGFFLLGIFSHSQTDLVLFSAVMVVFTVALCGNVLLIFLIYLDAGLHTPMYFFLSQLSLM      1 - 70
DLMLVCNIVPKMAANFLSGRKSISFVGCGIQIGFFVSLVGSEGLLLGLMAYDRYVAVSHPLHYPILMNQR     71 - 140
VCLQITGSSWAFGIIDGVIQMVAAMGLPYCGSRSVDHFFCEVQALLKLACADTSLFDTLLFACCVFMLLL    141 - 210
PFSIIMASYACILGAVLRIRSAQAWKKALATCSSHLTAVTLFYGAAMFMYLRPRRYRAPSHDKVASIFYT    211 - 280
VLTPMLNPLIYSLRNGEVMGALRKGLDRCRIGSQH                                       281 - 315
//

Text Mined References (1)

PMID Year Title
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.