Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MGFYHVGQAAFELLTSSFILVGFSDRPHLELIVFVVVLIFYLLTLLGNMTIVLLSALDSRLHTPMYFFLA      1 - 70
NLSFLDMCFTTGSIPQMLYNLWGPDKTISYVGCAIQLYFVLALGGVECVLLAVMAYDRYAAVCKPLHYTI     71 - 140
IMHPRLCGQLASVAWLSGFGNSLIMAPQTLMLPRCGHRRVDHFLCEMPALIGMACVDTMMLEALAFALAI    141 - 210
FIILAPLILILISYGYVGGTVLRIKSAAGRKKAFNTCSSHLIVVSLFYGTIIYMYLQPANTYSQDQGKFL    211 - 280
TLFYTIVTPSVNPLIYTLRNKDVKEAMKKVLGKGSAEI                                    281 - 318
//

Text Mined References (1)

PMID Year Title
14983052 2004 The human olfactory receptor gene family.