Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MVSANQTASVTEFILLGLSAHPKLEKTFFVLILLMYLVILLGNGVLILMTVSNSHLHMPMYFFLGNLSFL      1 - 70
DICYTTSSVPLILDSFLTPRKTISFSACAVQMFLSFAMGATECVLLSMMAFDRYVAICNPLRYPVVMSKA     71 - 140
AYMPIRLPAPG                                                               141 - 151
//

Text Mined References (2)

PMID Year Title
15164053 2004 DNA sequence and analysis of human chromosome 9.
12906860 2003 Organization and evolutionary relatedness of OR37 olfactory receptor genes in mouse and human.