Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent (163)

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
diabetes mellitus 1663 0.00132077039541833

Synonym

Accession Q8NH87 Q6IEU9 Q8NGQ0
Symbols OR9G5

Gene

PANTHER Protein Class (2)

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG
Rat OMA EggNOG
Horse OMA EggNOG
Opossum EggNOG Inparanoid

AA Sequence

MQRSNHTVTEFILLGFTTDPGMQLGLFVVFLGVYSLTVVGNSTLIVLICNDSCLHTPMYFFTGNLSFLDL      1 - 70
WYSSVYTPKILVTCISEDKSISFAGCLCQFFFSAGLAYSECYLLAAVAYDRYVAISKPLLYAQAMSIKLC     71 - 140
ALLVAVSYCGGFINSSIITKKTFSFNFCRENIIDDFFCDLLPLVELACGEKGGYKIMMYFLLASNVICPA    141 - 210
VLILASYLFIITSVLRISSSKGYLKAFSTCSSHLTSVTLYYGSILYIYALPRSSYSFDMDKIVSTFYTVV    211 - 280
FPMLNLMIYSLRNKDVKEALKKLLP                                                 281 - 305
//

Text Mined References (2)

PMID Year Title
17903294 2007 Genome-wide association and linkage analyses of hemostatic factors and hematological phenotypes in the Framingham Heart Study.
14983052 2004 The human olfactory receptor gene family.