Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.20

Knowledge Summary

Patent (87)

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Lymphoid leukemia 160 0.0 3.0
Disease Target Count Z-score Confidence
Male infertility 206 3.251 1.6

AA Sequence

MAEVNIIYVTVFILKGITNRPELQAPCFGVFLVIYLVTVLGNLGLITLIKIDTRLHTPMYYFLSHLAFVD      1 - 70
LCYSSAITPKMMVNFVVERNTIPFHACATQLGCFLTFMITECFLLASMAYDCYVAICSPLHYSTLMSRRV     71 - 140
CIQLVAVPYIYSFLVALFHTVITFRLTYCGPNLINHFYCDDLPFLALSCSDTHMKEILIFAFAGFDMISS    141 - 210
SSIVLTSYIFIIAAILRIRSTQGQHKAISTCGSHMVTVTIFYGTLIFMYLQPKSNHSLDTDKMASVFYTV    211 - 280
VIPMLNPLIYSLRNKEVKDASKKALDKGCENLQILTFLKIRKLY                              281 - 324
//

Text Mined References (3)

PMID Year Title