Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent (52)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
osteosarcoma 7,933

AA Sequence

MEVKNCCMVTEFILLGIPHTEGLEMTLFVLFLPFYACTLLGNVSILVAVMSSARLHTPMYFFLGNLSVFD      1 - 70
MGFSSVTCPKMLLYLMGLSRLISYKDCVCQLFFFHFLGSIECFLFTVMAYDRFTAICYPLRYTVIMNPRI     71 - 140
CVALAVGTWLLGCIHSSILTSLTFTLPYCGPNEVDHFFCDIPALLPLACADTSLAQRVSFTNVGLISLVC    141 - 210
FLLILLSYTRITISILSIRTTEGRRRAFSTCSAHLIAILCAYGPIITVYLQPTPNPMLGTVVQILMNLVG    211 - 280
PMLNPLIYTLRNKEVKTALKTILHRTGHVPES                                          281 - 312
//

Text Mined References (2)

PMID Year Title
14983052 2004 The human olfactory receptor gene family.
1370859 1992 Expression of members of the putative olfactory receptor gene family in mammalian germ cells.