Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.07
PubTator Score 0.08

Knowledge Summary

Patent (104)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

AA Sequence

MRNGTVITEFILLGFPVIQGLQTPLFIAIFLTYILTLAGNGLIIATVWAEPRLQIPMYFFLCNLSFLEIW      1 - 70
YTTTVIPKLLGTFVVARTVICMSCCLLQAFFHFFVGTTEFLILTIMSFDRYLTICNPLHHPTIMTSKLCL     71 - 140
QLALSSWVVGFTIVFCQTMLLIQLPFCGNNVISHFYCDVGPSLKAACIDTSILELLGVIATILVIPGSLL    141 - 210
FNMISYIYILSAILRIPSATGHQKTFSTCASHLTVVSLLYGAVLFMYLRPTAHSSFKINKVVSVLNTILT    211 - 280
PLLNPFIYTIRNKEVKGALRKAMTCPKTGHAK                                          281 - 312
//

Text Mined References (4)

PMID Year Title