Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.07
PubTator Score 0.08

Knowledge Summary

Patent (104)

AA Sequence

MRNGTVITEFILLGFPVIQGLQTPLFIAIFLTYILTLAGNGLIIATVWAEPRLQIPMYFFLCNLSFLEIW      1 - 70
YTTTVIPKLLGTFVVARTVICMSCCLLQAFFHFFVGTTEFLILTIMSFDRYLTICNPLHHPTIMTSKLCL     71 - 140
QLALSSWVVGFTIVFCQTMLLIQLPFCGNNVISHFYCDVGPSLKAACIDTSILELLGVIATILVIPGSLL    141 - 210
FNMISYIYILSAILRIPSATGHQKTFSTCASHLTVVSLLYGAVLFMYLRPTAHSSFKINKVVSVLNTILT    211 - 280
PLLNPFIYTIRNKEVKGALRKAMTCPKTGHAK                                          281 - 312
//

Text Mined References (4)

PMID Year Title
23967269 2013 A genome-wide association study of total serum and mite-specific IgEs in asthma patients.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.