Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent (110)

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
diabetes mellitus 1663 0.00140828730488041

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.100 0.001

Synonym

Accession Q8NH76 Q6IFD7
Symbols OR11-67

Gene

  Ortholog (3)

Species Source
Chimp OMA EggNOG
Rat OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid

AA Sequence

MDTSTSVTYDSSLQISQFILMGLPGIHEWQHWLSLPLTLLYLLALGANLLIIITIQHETVLHEPMYHLLG      1 - 70
ILAVVDIGLATTIMPKILAIFWFDAKAISLPMCFAQIYAIHCFFCIESGIFLCMAVDRYIAICRPLQYPS     71 - 140
IVTKAFVFKATGFIMLRNGLLTIPVPILAAQRHYCSRNEIEHCLCSNLGVISLACDDITVNKFYQLMLAW    141 - 210
VLVGSDMALVFSSYAVILHSVLRLNSAEAMSKALSTCSSHLILILFHTGIIVLSVTHLAEKKIPLIPVFL    211 - 280
NVLHNVIPPALNPLACALRMHKLRLGFQRLLGLGQDVSK                                   281 - 319
//

Text Mined References (3)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.