Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent (110)

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1728 1.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.100 1.4e-03

AA Sequence

MDTSTSVTYDSSLQISQFILMGLPGIHEWQHWLSLPLTLLYLLALGANLLIIITIQHETVLHEPMYHLLG      1 - 70
ILAVVDIGLATTIMPKILAIFWFDAKAISLPMCFAQIYAIHCFFCIESGIFLCMAVDRYIAICRPLQYPS     71 - 140
IVTKAFVFKATGFIMLRNGLLTIPVPILAAQRHYCSRNEIEHCLCSNLGVISLACDDITVNKFYQLMLAW    141 - 210
VLVGSDMALVFSSYAVILHSVLRLNSAEAMSKALSTCSSHLILILFHTGIIVLSVTHLAEKKIPLIPVFL    211 - 280
NVLHNVIPPALNPLACALRMHKLRLGFQRLLGLGQDVSK                                   281 - 319
//

Text Mined References (3)

PMID Year Title