Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.25
PubTator Score 1.25

Knowledge Summary

Patent (114)

AA Sequence

MEKINNVTEFIFWGLSQSPEIEKVCFVVFSFFYIIILLGNLLIMLTVCLSNLFKSPMYFFLSFLSFVDIC      1 - 70
YSSVTAPKMIVDLLAKDKTISYVGCMLQLFGVHFFGCTEIFILTVMAYDRYVAICKPLHYMTIMNRETCN     71 - 140
KMLLGTWVGGFLHSIIQVALVVQLPFCGPNEIDHYFCDVHPVLKLACTETYIVGVVVTANSGTIALGSFV    141 - 210
ILLISYSIILVSLRKQSAEGRRKALSTCGSHIAMVVIFFGPCTFMYMRPDTTFSEDKMVAVFYTIITPML    211 - 280
NPLIYTLRNAEVKNAMKKLWGRNVFLEAKGK                                           281 - 311
//

Text Mined References (4)

PMID Year Title
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
14983052 2004 The human olfactory receptor gene family.
12644552 2003 Population differences in the human functional olfactory repertoire.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.