Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.28
PubTator Score 0.39

Knowledge Summary

Patent (110)

TINX Plot

  Disease Relevance (3)

AA Sequence

MFYHNKSIFHPVTFFLIGIPGLEDFHMWISGPFCSVYLVALLGNATILLVIKVEQTLREPMFYFLAILST      1 - 70
IDLALSTTSVPRMLGIFWFDAHEINYGACVAQMFLIHAFTGMEAEVLLAMAFDRYVAVCAPLHYATILTS     71 - 140
QVLVGISMCIVIRPVLLTLPMVYLIYRLPFCQAHIIAHSYCEHMGIAKLSCGNIRINGIYGLFVVSFFVL    141 - 210
NLVLIGISYVYILRAVFRLPSHDAQLKALSTCGAHVGVICVFYIPSVFSFLTHRFGHQIPGYIHILVANL    211 - 280
YLIIPPSLNPIIYGVRTKQIRERVLYVFTKK                                           281 - 311
//

Text Mined References (2)

PMID Year Title
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
14983052 2004 The human olfactory receptor gene family.