Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.28
PubTator Score 0.39

Knowledge Summary

Patent (110)

TINX Plot

  Disease (4)

Disease Target Count P-value
diabetes mellitus 1728 1.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Hemolytic anemia 77 0.0 3.0
Disease Target Count Z-score Confidence
Anorexia nervosa 80 3.149 1.6

AA Sequence

MFYHNKSIFHPVTFFLIGIPGLEDFHMWISGPFCSVYLVALLGNATILLVIKVEQTLREPMFYFLAILST      1 - 70
IDLALSTTSVPRMLGIFWFDAHEINYGACVAQMFLIHAFTGMEAEVLLAMAFDRYVAVCAPLHYATILTS     71 - 140
QVLVGISMCIVIRPVLLTLPMVYLIYRLPFCQAHIIAHSYCEHMGIAKLSCGNIRINGIYGLFVVSFFVL    141 - 210
NLVLIGISYVYILRAVFRLPSHDAQLKALSTCGAHVGVICVFYIPSVFSFLTHRFGHQIPGYIHILVANL    211 - 280
YLIIPPSLNPIIYGVRTKQIRERVLYVFTKK                                           281 - 311
//

Text Mined References (2)

PMID Year Title