Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.67
PubTator Score 2.50

Knowledge Summary

Patent (110)

Gene RIF (2)

PMID Text
17964544 Observational study of gene-disease association. (HuGE Navigator)
17964544 study identified novel nSNP in OR4X1 gene (rs10838851, Tyr273Ter*), which is significantly associated with FEV1.0/FVC value in pulmonary function test in a Japanese population

AA Sequence

MVATNNVTEIIFVGFSQNWSEQRVISVMFLLMYTAVVLGNGLIVVTILASKVLTSPMYFFLSYLSFVEIC      1 - 70
YCSVMAPKLIFDSFIKRKVISLKGCLTQMFSLHFFGGTEAFLLMVMAYDRYVAICKPLHYMAIMNQRMCG     71 - 140
LLVRIAWGGGLLHSVGQTFLIFQLPFCGPNIMDHYFCDVHPVLELACADTFFISLLIITNGGSISVVSFF    141 - 210
VLMASYLIILHFLRSHNLEGQHKALSTCASHVTVVDLFFIPCSLVYIRPCVTLPADKIVAVFYTVVTPLL    211 - 280
NPVIYSFRNAEVKNAMRRFIGGKVI                                                 281 - 305
//

Text Mined References (4)

PMID Year Title
22908908 2012 Personal receptor repertoires: olfaction as a model.
17964544 2007 A nonfunctioning single nucleotide polymorphism in olfactory receptor gene family is associated with the forced expiratory volume in the first second/the forced vital capacity values of pulmonary function test in a Japanese population.
16939646 2006 A probabilistic classifier for olfactory receptor pseudogenes.
14983052 2004 The human olfactory receptor gene family.