Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00
PubTator Score 0.33

Knowledge Summary

Patent (145)

AA Sequence

MENKTEVTQFILLGLTNDSELQVPLFITFPFIYIITLVGNLGIIVLIFWDSCLHNPMYFFLSNLSLVDFC      1 - 70
YSSAVTPIVMAGFLIEDKVISYNACAAQMYIFVAFATVENYLLASMAYDRYAAVCKPLHYTTTMTTTVCA     71 - 140
RLAIGSYLCGFLNASIHTGDTFSLSFCKSNEVHHFFCDIPAVMVLSCSDRHISELVLIYVVSFNIFIALL    141 - 210
VILISYTFIFITILKMHSASVYQKPLSTCASHFIAVGIFYGTIIFMYLQPSSSHSMDTDKMAPVFYTMVI    211 - 280
PMLNPLVYSLRNKEVKSAFKKVVEKAKLSVGWSV                                        281 - 314
//

Text Mined References (1)

PMID Year Title
14983052 2004 The human olfactory receptor gene family.