Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent (183)

Gene RIF (1)

PMID Text
18976975 Knockdown of olfactory receptor, family 6, subfamily S, member 1 (OR6S1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MSPDGNHSSDPTEFVLAGLPNLNSARVELFSVFLLVYLLNLTGNVLIVGVVRADTRLQTPMYFFLGNLSC      1 - 70
LEILLTSVIIPKMLSNFLSRQHTISFAACITQFYFYFFLGASEFLLLAVMSADRYLAICHPLRYPLLMSG     71 - 140
AVCFRVALACWVGGLVPVLGPTVAVALLPFCKQGAVVQHFFCDSGPLLRLACTNTKKLEETDFVLASLVI    141 - 210
VSSLLITAVSYGLIVLAVLSIPSASGRQKAFSTCTSHLIVVTLFYGSAIFLYVRPSQSGSVDTNWAVTVI    211 - 280
TTFVTPLLNPFIYALRNEQVKEALKDMFRKVVAGVLGNLLLDKCLSEKAVK                       281 - 331
//

Text Mined References (1)

PMID Year Title
14983052 2004 The human olfactory receptor gene family.