Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 6.00

Knowledge Summary

Patent (189)

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1728 1.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

AA Sequence

MENYNQTSTDFILLGLFPQSRIGLFVFTLIFLIFLMALIGNLSMILLIFLDIHLHTPMYFLLSQLSLIDL      1 - 70
NYISTIVPKMVYDFLYGNKSISFTGCGIQSFFFLTLAVAEGLLLTSMAYDRYVAICFPLHYPIRISKRVC     71 - 140
VMMITGSWMISSINSCAHTVYALCIPYCKSRAINHFFCDVPAMLTLACTDTWVYESTVFLSSTIFLVLPF    141 - 210
TGIACSYGRVLLAVYRMHSAEGRKKAYSTCSTHLTVVSFYYAPFAYTYVRPRSLRSPTEDKILAVFYTIL    211 - 280
TPMLNPIIYSLRNKEVMGALTQVIQKIFSVKM                                          281 - 312
//

Text Mined References (4)

PMID Year Title