Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.04
PubTator Score 0.10

Knowledge Summary

Patent (125)

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Urinary Bladder Neoplasms 114 0.0 0.0
Disease Target Count
Bladder Neoplasm 112
Disease Target Count P-value
psoriasis 6694 2.2e-04

Gene RIF (1)

AA Sequence

MALGNHSTITEFLLLGLSADPNIRALLFVLFLGIYLLTIMENLMLLLMIRADSCLHKPMYFFLSHLSFVD      1 - 70
LCFSSVIVPKMLENLLSQRKTISVEGCLAQVFFVFVTAGTEACLLSGMAYDRHAAICRPLLYGQIMGKQL     71 - 140
YMHLVWGSWGLGFLDALINVLLAVNMVFCEAKIIHHYSYEMPSLLPLSCSDISRSLIALLCSTLLHGLGN    141 - 210
FLLVFLSYTRIISTILSISSTSGRSKAFSTCSAHLTAVTLYYGSGLLRHLMPNSGSPIELIFSVQYTVVT    211 - 280
PMLNSLIYSLKNKEVKGERSLRDSSHLPQLHKGQARWKRPAFTEGRREPGHPELSIPVTPQPQGACACSA    281 - 350
LRAAPTALP                                                                 351 - 359
//

Text Mined References (4)

PMID Year Title