Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.04
PubTator Score 0.10

Knowledge Summary

Patent (125)

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Bladder Neoplasm 109
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.700 0.000

Gene RIF (1)

PMID Text
20677014 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MALGNHSTITEFLLLGLSADPNIRALLFVLFLGIYLLTIMENLMLLLMIRADSCLHKPMYFFLSHLSFVD      1 - 70
LCFSSVIVPKMLENLLSQRKTISVEGCLAQVFFVFVTAGTEACLLSGMAYDRHAAICRPLLYGQIMGKQL     71 - 140
YMHLVWGSWGLGFLDALINVLLAVNMVFCEAKIIHHYSYEMPSLLPLSCSDISRSLIALLCSTLLHGLGN    141 - 210
FLLVFLSYTRIISTILSISSTSGRSKAFSTCSAHLTAVTLYYGSGLLRHLMPNSGSPIELIFSVQYTVVT    211 - 280
PMLNSLIYSLKNKEVKGERSLRDSSHLPQLHKGQARWKRPAFTEGRREPGHPELSIPVTPQPQGACACSA    281 - 350
LRAAPTALP                                                                 351 - 359
//

Text Mined References (4)

PMID Year Title
24105470 2014 A meta-analysis of genome-wide association studies for adiponectin levels in East Asians identifies a novel locus near WDR11-FGFR2.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16541075 2006 The finished DNA sequence of human chromosome 12.