Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
diabetes mellitus 1,663

Expression

AA Sequence

MGLTQDFFPPTSELLEGGNQTSTFEFLLWGLSDQPQQQHIFFLLFLWMYVVTVAGNLLIVLAIGTDTHLH      1 - 70
TPMYFFLASLSCADIFSTSTTVPKALVNIQTQSRSISYAGCLAQLYFFLTFGDMDIFLPATMAYDRYVAI     71 - 140
CHLLHYMMIMSLHRCAFLVTACWTLTSLLAMTRTFLIFRLSLCSAILPGFFCDLGPLMKVSCSDAQVNEL    141 - 210
VLLFLGGAVILIPFMLILVSYIRIVSAILRAPSAQGRRKAFSTCDSHLVVVALFFGTVIRAYLCPSSSSS    211 - 280
NSVKEDTAAAVMYTVVTPLLNPFIYSMRNKDMKAAVVRLLKGRVSFSQGQ                        281 - 330
//

Text Mined References (5)

PMID Year Title
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
14983052 2004 The human olfactory receptor gene family.
12730696 2003 Different noses for different people.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
10673334 2000 Sequence, structure, and evolution of a complete human olfactory receptor gene cluster.