Property Summary

NCBI Gene PubMed Count 2
PubMed Score 10.00
PubTator Score 13.90

Knowledge Summary

Patent (281)

AA Sequence

MKKEQDSNVTEFVLLGLSSSWELQLFLFLLFLFFYIAIVLGNLLIVVTVQAHAHLLQSPMYYFLGHLSFI      1 - 70
DLCLSCVTVPKMLGDFLQQGKSISFSGCLAQIYFLHFLGASEMFLLTVMAYDRYVAICNPLRYLTVMNPQ     71 - 140
LCLWLVLACWCGGFIHSIMQVILVIQLPFCGPNELDNFYCDVPQVIKLACMDTYVVEVLVIANSGLLSLV    141 - 210
CFLVLLFSYAIILITLRTHFCQGQNKVFSTCASHLTVVSLIFVPCVFIYLRPFCSFSVDKIFSLFYTVIT    211 - 280
PMLNPLIYTLRNTDMKTAMKKLRIKPCGIPLPC                                         281 - 313
//

Text Mined References (2)

PMID Year Title