Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.00
PubTator Score 0.50

Knowledge Summary

Patent (188)


  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Pulmonary hypertension 86 3.041 1.5

AA Sequence

AFYTIFTPVLNPLIYSLRNKDVTRALRSMMQSRMNQEK                                    281 - 318

Text Mined References (3)

PMID Year Title